10% Off Sitewide Until 2/16
Home devacurlstyle & shapeclean beauty
Can't find a Product?

devacurl style & shape

BRAND GENERIC Double DevaCurl Logo
BRAND GENERIC Double DevaCurl
(10 Items)
  • 109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False
    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    ULTRA DEFINING GEL Strong Hold No-Crunch Styler
    Bonus Offer
    On SaleLog in to view pricing!
    View Sizes
  • 109682 491414 491414 1 DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. DevaCurl DevaCurl DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. False devacurl/devacurldevafresh.jpg Bonus Deal Available 12.25 12.25 12.25 False False False False 0.00 False False Diversion contract is required DevaCurl DEVAFRESH Scalp & Hair Revitalizer is a style-extending spray with the Time Released Freshness Complex that maintains moisture, reduces frizz, and provides 48 hour odor control and a cooling scalp sensation. True Log in to view pricing! False
    DevaCurl DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz.

    DevaCurl
    DEVAFRESH Scalp & Hair Revitalizer

    3 Fl. Oz.

    SKU 491414
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 109721 491417 491417 1 FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. DevaCurl DevaCurl FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. False devacurl/devagsflexfactor8oz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required DevaCurl FLEXFACTOR Curl Protection & Retention Primer is a heat and UV protective spray with the Curl Memory Complex protects from breakage from friction. True Log in to view pricing! False
    DevaCurl FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz.

    DevaCurl
    FLEXFACTOR Curl Protection & Retention Primer

    8 Fl. Oz.

    SKU 491417
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 109679 491432 491432 1 FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. DevaCurl DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. False devacurl/devacurlflexibleholdhairspray.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler is a flexible hold hairspray. True Log in to view pricing! False
    DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz.

    DevaCurl
    FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

    10 Fl. Oz.

    SKU 491432
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 109723 491418 491418 1 FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster 8 Fl. Oz. DevaCurl DevaCurl FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsfrizzfightingvolumizingfoam8oz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required DevaCurl FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster gives your curls a body boost! True Log in to view pricing! False
    DevaCurl FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster 8 Fl. Oz.

    DevaCurl
    FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster

    8 Fl. Oz.

    SKU 491418
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 109741 491431 491431 1 MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. DevaCurl DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsmoistureseal8oz.jpg Bonus Deal Available 16.65 16.65 16.65 False False False False 0.00 False False Diversion contract is required DevaCurl MOISTURE SEAL Hydrating Finishing Spray previously SET IT FREE, is a lightweight formula with a moisture locking blend brings much-needed hydration to dry curls helping to fight frizz and provide softness and shine. True Log in to view pricing! False
    DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz.

    DevaCurl
    MOISTURE SEAL Hydrating Finishing Spray

    8 Fl. Oz.

    SKU 491431
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 109742 491415 491415 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. False devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False
    DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz.

    DevaCurl
    PLUMPING PRIMER Body-Building Gelée

    5 Fl. Oz.

    SKU 491415
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 109745 491426 491426 1 STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. DevaCurl DevaCurl STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. True devacurl/devacurlnewpackagingdevacurlstylingcream51oz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required DevaCurl STYLING CREAM Touchable Moisturizing Definer is a rich cream with a hydra-definition blend provides medium to coarse curls with shape, frizz control, and a no-crunch finish. True Log in to view pricing! False
    DevaCurl STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz.

    DevaCurl
    STYLING CREAM Touchable Moisturizing Definer
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 109748 491427 491427 1 SUPERCREAM Rich Coconut-Infused Definer 5.1 Fl. Oz. DevaCurl DevaCurl SUPERCREAM Rich Coconut-Infused Definer 5.1 Fl. Oz. False devacurl/devacurlnewpackagingdevagssupercream51oz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required DevaCurl SUPERCREAM Rich Coconut-Infused Definer is a multitasking, ultra-rich cream with a hydra-definition blend that provides coarse curls with smoothness, shape, shine, and frizz control. True Log in to view pricing! False
    DevaCurl SUPERCREAM Rich Coconut-Infused Definer 5.1 Fl. Oz.

    DevaCurl
    SUPERCREAM Rich Coconut-Infused Definer

    5.1 Fl. Oz.

    SKU 491427
    Bonus Offer
    Log in to view pricing!
    Quick View
(10 Items)