hair care shampoo

May/June Promos are now available! Shop Here!

(57 Items)

105783 298131P 298131P 1 repair salon launch 14 pc. amika: amika: repair salon launch 14 pc. False amika/amikarepairsalonlaunch.jpg Bonus Deal Available 151.50 151.50 151.50 False True False False 0.00 False False Diversion contract is required 0 amika: repair salon launch features several products from the repair line. True Log in to view pricing! False

amika:
repair salon launch

14 pc.

SKU 298131P

Promotional ItemLog in to view pricing!
Quick View
22744 251363 251363 1 MELU/ shampoo 8.45 Fl. Oz. Davines Davines Essential Haircare MELU/ shampoo 8.45 Fl. Oz. True davines/davinesmelushampoo845floz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False True Diversion contract is required 0 Davines Essential Haircare MELU/ shampoo is a breakage-preventing and shine-giving shampoo, it also gives silkiness and light to the hair. True Log in to view pricing! False

Davines
Essential Haircare MELU/ shampoo

On SaleLog in to view pricing!
View Sizes
22668 251308 251308 1 NOUNOU/ shampoo 8.45 Fl. Oz. Davines Davines Essential Haircare NOUNOU/ shampoo 8.45 Fl. Oz. True davines/davinesnounoushampoo845floz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False True Diversion contract is required 0 Davines Essential Haircare NOUNOU/ shampoo is a nourishing shampoo that gives body to the hair. True Log in to view pricing! False

Davines
Essential Haircare NOUNOU/ shampoo

On SaleLog in to view pricing!
View Sizes
18738 251256 251256 1 Shampoo 8.45 Fl. Oz. Davines Davines NaturalTech Rebalancing Shampoo 8.45 Fl. Oz. True davines/rebalancing2shampoo250.jpg Bonus Deal Available 18.00 18.00 18.00 False False False False 0.00 False True Diversion contract is required 0 Davines NaturalTech Rebalancing Shampoo is a normalizing and rebalancing formula for problems of excess sebum production. True Log in to view pricing! False

Davines
NaturalTech Rebalancing Shampoo

On SaleLog in to view pricing!
View Sizes
76047 182393 182393 1 Protective Shampoo 10 Fl. Oz. Joico Joico Defy Damage Protective Shampoo 10 Fl. Oz. True joico/joidefyshampoo10.jpg Bonus Deal Available 13.90 13.90 13.90 False False False False 0.00 False False Diversion contract is required 0 Joico Defy Damage Protective Shampoo is made for bond strengthening and color longevity. True Log in to view pricing! False

Joico
Defy Damage Protective Shampoo

On SaleLog in to view pricing!
View Sizes
8153 181063 181063 1 Shampoo Gallon Joico Joico Moisture Recovery Shampoo Gallon False joico/joico-moisture-recovery-shampoo-gallon.jpg Bonus Deal Available 60.00 60.00 29.99 True False False False 29.99 False False Diversion contract is required 0 Dry-to-extremely-dry strands that are panting for a rescue. True Log in to view pricing! False

Joico
Moisture Recovery Shampoo

Gallon

SKU 181063

On SaleLog in to view pricing!
Quick View
49034 624129 624129 1 Shampoo 10.1 Fl. Oz. L'ANZA L'ANZA KERATIN HEALING OIL Shampoo 10.1 Fl. Oz. True lanza/keratinshampoo300.jpg Bonus Deal Available 22.25 22.25 16.68 True False False False 16.68 False False Diversion contract is required 0 Keratin Healing Oil Shampoo replenishes vital Keratin Protein to restore hair’s volume, strength and health. True Log in to view pricing! False

L'ANZA
KERATIN HEALING OIL Shampoo

On SaleLog in to view pricing!
View Sizes
70751 119001 119001 1 Daily Shampoo 12 Fl. Oz. LOMA LOMA Daily Shampoo 12 Fl. Oz. True loma/lomadailysh12oz.jpg Bonus Deal Available 9.50 9.50 9.50 False False False False 0.00 False False Diversion contract is required 0 LOMA Daily Shampoo contains certified organic ingredients specifically selected to enhance, protect, restore and repair the hairs natural moisture balance while providing vibrant shine. True Log in to view pricing! False

LOMA
Daily Shampoo

On SaleLog in to view pricing!
View Sizes
81575 756180 756180 1 Cleanse Lightweight Healing Shampoo 11 Fl. Oz. PRAVANA PRAVANA Intense Therapy Cleanse Lightweight Healing Shampoo 11 Fl. Oz. True pravana/pravanaintensetherapycleanse11oz.jpg Bonus Deal Available 10.99 10.99 8.80 True False False False 8.80 False False Diversion contract is required 0 PRAVANA INTENSE THERAPY Cleanse Lightweight Healing Shampoo thoroughly cleanses and removes buildup while replenishing hair. True Log in to view pricing! False

PRAVANA
Intense Therapy Cleanse Lightweight Healing Shampoo

On SaleLog in to view pricing!
View Sizes
137690 595265 595265 1 Deep Cleansing Shampoo 16.9 Fl. Oz. Alfaparf Milano Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo 16.9 Fl. Oz. False alfaparfmilano/alfaparfmilanoktlddeepcleansingshampoo16oz.jpg Bonus Deal Available 22.50 22.50 22.50 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo washes thoroughly and untangles hair perfectly. True Log in to view pricing! False

Alfaparf Milano
Lisse Design Keratin Therapy Deep Cleansing Shampoo

16.9 Fl. Oz.

SKU 595265

Log in to view pricing!
Quick View
65391 595278 595278 1 Reparative Low Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/am_sdl-reconstruction-reparative-low-shampoo-8-45_oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo is a gentle restructuring shampoo for damaged hair. True Log in to view pricing! False

Alfaparf Milano
Semi Di Lino Reconstruction Reparative Low Shampoo

Log in to view pricing!
View Sizes
89166 595318 595318 1 Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. False alfaparfmilano/alfaparfsdlscalprenewenergyshampoo8.45oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo gently strengthens, re-densifies and stimulates the hair follicles so that both the scalp and hair fibers can regain balance, strength and body. True Log in to view pricing! False

Alfaparf Milano
Semi Di Lino Scalp Renew Energizing Low Shampoo

8.45 Fl. Oz.

SKU 595318

Log in to view pricing!
Quick View
12874 641508 641508 1 Essential 7 Oil Cleansing Oil Shampoo 10.1 Fl. Oz. Aloxxi Aloxxi Essential 7 Oil Cleansing Oil Shampoo 10.1 Fl. Oz. False aloxxi/aloxxie7oshampoo10oz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required 0 Aloxxi Essential 7 Oil Cleansing Oil Shampoo is an intense hydrating shampoo for dry, coarse, color treated hair. True Log in to view pricing! False

Aloxxi
Essential 7 Oil Cleansing Oil Shampoo

10.1 Fl. Oz.

SKU 641508

Log in to view pricing!
Quick View
27504 641525 641525 1 Reparative Shampoo 10.1 Fl. Oz. Aloxxi Aloxxi Reparative Shampoo 10.1 Fl. Oz. True aloxxi/aloxxireparativeshampoo10ozpump.jpg Bonus Deal Available 13.90 13.90 13.90 False False False False 0.00 False False Diversion contract is required 0 Aloxxi's Reparative Shampoo renews damaged hair and restores hydration without stripping strands of nourishment. True Log in to view pricing! False

Aloxxi
Reparative Shampoo

Log in to view pricing!
View Sizes
33703 795001 795001 1 Shampoo 8.5 Fl. Oz. ALTERNA Professional ALTERNA Professional Caviar Anti-Aging Replenishing MOISTURE Shampoo 8.5 Fl. Oz. True alternaprofessional/alternaprofessionalreplenishingmoistureshampoo8oz.jpg Bonus Deal Available 18.00 18.00 18.00 False False False False 0.00 False False Diversion contract is required 0 ALTERNA Professional Caviar Anti-Aging Replenishing MOISTURE Shampoo helps to restore and rebalance moisture to hair for noticeably softer, smoother, shinier hair that feels transformed after one use. True Log in to view pricing! False

ALTERNA Professional
Caviar Anti-Aging Replenishing MOISTURE Shampoo

Log in to view pricing!
View Sizes