clean beauty sulfate-free

17193 A New Colour A New Colour 1 Ammonia Free Permanent Hair Colour Click to View Colors Davines Davines A New Colour Ammonia Free Permanent Hair Colour Click to View Colors False davines/davinesanctubemaster.jpg Bonus Deal Available 8.95 8.95 8.95 False False False False 0.00 True False Diversion contract is required Davines A New Colour Ammonia-Free Permanent Colour Cream is an ammonia-free permanent colouring system designed and formulated to offer total coverage and perfect lifting. True Log in to view pricing! False

Davines Ammonia Free Permanent Hair Colour

Davines
A New Colour Ammonia Free Permanent Hair Colour

Log in to view pricing!

View Details

18355 Finest Pigments Finest Pigments 1 Gel Color Formula Click to View Colors Davines Davines Finest Pigments Gel Color Formula Click to View Colors False davines/finestpigments.jpg Bonus Deal Available 27.00 27.00 27.00 False False False False 0.00 True False Diversion contract is required Davines Finest Pigments is an ammonia-free direct gel color for hair. True Log in to view pricing! False

Davines
Finest Pigments Gel Color Formula

Log in to view pricing!

View Details

28103 Mask with Vibrachrom Mask with Vibrachrom 1 Permanent Color Click to View Colors Davines Davines Mask with Vibrachrom Permanent Color Click to View Colors False davines/davinesmwvmastermasktubeandouter338floz.jpg Bonus Deal Available 8.95 8.95 8.95 False False False False 0.00 True False Diversion contract is required Davines Mask with Vibrachrom is a permanent hair color that provides extra shine, a high conditioning effect, and outstanding duration. True Log in to view pricing! False

Davines
Mask with Vibrachrom Permanent Color

Log in to view pricing!

View Details

91932 298038 298038 1 flash instant shine mask 6.7 Fl. Oz. amika: amika: flash instant shine mask 6.7 Fl. Oz. False amika/amikaflashinstantshinemask67ozv2.jpg Bonus Deal Available 17.50 17.50 13.13 True False False False 13.13 False False Diversion contract is required From dull to dazzling! amika: flash instant shine mask's flash-acting mask delivers brilliant moisture and shine in just 60 seconds. True Log in to view pricing! False

amika:
flash instant shine mask

6.7 Fl. Oz.

SKU 298038

On SaleLog in to view pricing!

Quick View

17304 251184 251184 1 Bleaching Powder 16.9 Fl. Oz. Davines Davines A New Colour Bleaching Powder 16.9 Fl. Oz. False davines/davinesancbleachinpowder.jpg Bonus Deal Available 27.00 27.00 21.60 True False False False 21.60 False False Diversion contract is required Davines A New Colour Bleaching Powder does not contain ammonium persulfates (thus it is ammonia-free), it has very low volatility and ensures a controlled lightening process; it also contains a blue pigment for an anti-yellow effect. True Log in to view pricing! False

Davines
A New Colour Bleaching Powder

16.9 Fl. Oz.

SKU 251184

On SaleLog in to view pricing!

Quick View

23147 251467 251467 1 This is a Dry Texturizer 8.45 Fl. Oz. Davines Davines More Inside This is a Dry Texturizer 8.45 Fl. Oz. False davines/davinesmoreinsodedrytexturizer845floz.jpg Bonus Deal Available 22.00 22.00 17.60 True False False False 17.60 False True Diversion contract is required Davines More Inside This Is A Dry Texturizer gives the hair an instant full-bodied and tousled look without weighing it down. True Log in to view pricing! False

Davines
More Inside This is a Dry Texturizer

8.45 Fl. Oz.

SKU 251467

On SaleLog in to view pricing!

Quick View

20834 251386 251386 1 This is a Medium Hairspray 13.52 Fl. Oz. Davines Davines More Inside This is a Medium Hairspray 13.52 Fl. Oz. True davines/davinesmoreinsidemediumhairspray1352floz.jpg Bonus Deal Available 22.50 22.50 18.00 True False False False 18.00 False True Diversion contract is required Davines More Inside This Is A Medium Hairspray eliminates frizz, adds structure and provides extreme hold without leaving residue. True Log in to view pricing! False

Davines This is a Medium Hairspray 13.52 Fl. Oz.

Davines
More Inside This is a Medium Hairspray

On SaleLog in to view pricing!

View Sizes

23143 251468 251468 1 This is a Shimmering Mist 6.76 Fl. Oz. Davines Davines More Inside This is a Shimmering Mist 6.76 Fl. Oz. False davines/davinesmoreinsideshimmeringspray676floz.jpg Bonus Deal Available 20.50 20.50 16.40 True False False False 16.40 False True Diversion contract is required Davines More Inside This Is A Shimmering Mist adds gloss and fights frizz without weighing down hair. True Log in to view pricing! False

Davines
More Inside This is a Shimmering Mist

6.76 Fl. Oz.

SKU 251468

On SaleLog in to view pricing!

Quick View

20811 251385 251385 1 This is a Strong Hairspray 13.52 Fl. Oz. Davines Davines More Inside This is a Strong Hairspray 13.52 Fl. Oz. False davines/davinesmoreinsidestronghairspray1352floz.jpg Bonus Deal Available 22.50 22.50 18.00 True False False False 18.00 False True Diversion contract is required Davines More Inside This Is A Strong Hairspray is an invisible strong hold hairspray that gives the hair humidity-resistant structure without weighing it down. True Log in to view pricing! False

Davines
More Inside This is a Strong Hairspray

13.52 Fl. Oz.

SKU 251385

On SaleLog in to view pricing!

Quick View

37062 251805 251805 1 This is an Extra Strong Hairspray 13.52 Fl. Oz. Davines Davines More Inside This is an Extra Strong Hairspray 13.52 Fl. Oz. False davines/davinesmoreinsideextrastronghairspray1352floz.jpg Bonus Deal Available 22.50 22.50 18.00 True False False False 18.00 False True Diversion contract is required Davines More Inside This Is An Extra Strong Hairspray locks hair into place for as long as need be, without leaving tell-tale residue or stickiness. True Log in to view pricing! False

Davines
More Inside This is an Extra Strong Hairspray

13.52 Fl. Oz.

SKU 251805

On SaleLog in to view pricing!

Quick View

20836 251387 251387 1 This is an Invisible No Gas Spray 8.45 Fl. Oz. Davines Davines More Inside This is an Invisible No Gas Spray 8.45 Fl. Oz. False davines/davinesmoreinsidenogashairspray845floz.jpg Bonus Deal Available 21.00 21.00 16.80 True False False False 16.80 False True Diversion contract is required Davines More Inside This Is An Invisible No Gas Spray is a humidity-resistant, flexible non-aerosol hairspray for brushable hold and a natural, touchable finish. True Log in to view pricing! False

Davines
More Inside This is an Invisible No Gas Spray

8.45 Fl. Oz.

SKU 251387

On SaleLog in to view pricing!

Quick View

63664 252031 252031 1 Tolerance Ammonia-Free Hair Lightening Oil 30.43 Fl. Oz. Davines Davines The Century of Light Tolerance Ammonia-Free Hair Lightening Oil 30.43 Fl. Oz. False davines/davcoltolerance.jpg Bonus Deal Available 29.50 29.50 23.60 True False False False 23.60 False False Diversion contract is required Davines Century of Light Tolerance is an Ammonia-Free Hair Lightening Oil. True Log in to view pricing! False

Davines
The Century of Light Tolerance Ammonia-Free Hair Lightening Oil

30.43 Fl. Oz.

SKU 252031

On SaleLog in to view pricing!

Quick View

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 15.55 15.55 10.00 True False False False 10.00 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

109500 491401 491401 1 LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz. True devacurl/devagslowpoooriginal12oz(1).jpg Bonus Deal Available 15.55 15.55 8.00 True False False False 8.00 False False Diversion contract is required DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture is designed for dry, medium to coarse curls. True Log in to view pricing! False

DevaCurl
LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture

On SaleLog in to view pricing!

View Sizes

109530 491403 491403 1 NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoooriginal12oz(1).jpg Bonus Deal Available 15.55 15.55 8.00 True False False False 8.00 False False Diversion contract is required DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture designed for dry, medium to coarse curls. True Log in to view pricing! False

DevaCurl
NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

On SaleLog in to view pricing!

View Sizes

Davines
A New Colour Ammonia Free Permanent Hair Colour

Davines
Finest Pigments Gel Color Formula

Davines
Mask with Vibrachrom Permanent Color

amika:
flash instant shine mask

Davines
A New Colour Bleaching Powder

Davines
More Inside This is a Dry Texturizer

Davines
More Inside This is a Medium Hairspray

Davines
More Inside This is a Shimmering Mist

Davines
More Inside This is a Strong Hairspray

Davines
More Inside This is an Extra Strong Hairspray

Davines
More Inside This is an Invisible No Gas Spray

Davines
The Century of Light Tolerance Ammonia-Free Hair Lightening Oil

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

DevaCurl
LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture

DevaCurl
NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

As Seen on Instagram

Volume Pricing

Product Pack

clean beauty sulfate-free

DavinesA New Colour Ammonia Free Permanent Hair Colour

DavinesFinest Pigments Gel Color Formula

DavinesMask with Vibrachrom Permanent Color

amika:flash instant shine mask

DavinesA New Colour Bleaching Powder

DavinesMore Inside This is a Dry Texturizer

DavinesMore Inside This is a Medium Hairspray

DavinesMore Inside This is a Shimmering Mist

DavinesMore Inside This is a Strong Hairspray

DavinesMore Inside This is an Extra Strong Hairspray

DavinesMore Inside This is an Invisible No Gas Spray

DavinesThe Century of Light Tolerance Ammonia-Free Hair Lightening Oil

DevaCurlLIGHT DEFINING GEL Soft Hold No-Crunch Styler

DevaCurlLOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture

DevaCurlNO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

As Seen on Instagram

Processing Your Request

Davines
A New Colour Ammonia Free Permanent Hair Colour

Davines
Finest Pigments Gel Color Formula

Davines
Mask with Vibrachrom Permanent Color

amika:
flash instant shine mask

Davines
A New Colour Bleaching Powder

Davines
More Inside This is a Dry Texturizer

Davines
More Inside This is a Medium Hairspray

Davines
More Inside This is a Shimmering Mist

Davines
More Inside This is a Strong Hairspray

Davines
More Inside This is an Extra Strong Hairspray

Davines
More Inside This is an Invisible No Gas Spray

Davines
The Century of Light Tolerance Ammonia-Free Hair Lightening Oil

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

DevaCurl
LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture

DevaCurl
NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture