devacurl

(55 Items)
  • 109570 491410 491410 1 BUILDUP BUSTER Gentle Clarifying Cleanser 8 Fl. Oz. DevaCurl DevaCurl BUILDUP BUSTER Gentle Clarifying Cleanser 8 Fl. Oz. True devacurl/devagsbuildupbuster8oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl BUILDUP BUSTER Gentle Clarifying Cleanser is a non-stripping cleanser with Clarifying Complex helps remove product buildup on all curl types. True Log in to view pricing! False
    DevaCurl BUILDUP BUSTER Gentle Clarifying Cleanser 8 Fl. Oz.

    DevaCurl
    BUILDUP BUSTER Gentle Clarifying Cleanser

    Bonus Offer
    View Sizes
  • 109582 491447 491447 1 CURLBOND PRO BOOST Re-Coiling In-Salon Treatment Liter DevaCurl DevaCurl CURLBOND PRO BOOST Re-Coiling In-Salon Treatment Liter False devacurl/devacurlcurlbondproboost.jpg Bonus Deal Available 93.35 93.35 79.35 True False False False 79.35 False False Diversion contract is required 0 DevaCurl CURLBOND PRO BOOST Re-Coiling In-Salon Treatment tames frizz for up to 50 washes and maintains the integrity of hair after a color service. True Log in to view pricing! False
    DevaCurl CURLBOND PRO BOOST Re-Coiling In-Salon Treatment Liter

    DevaCurl
    CURLBOND PRO BOOST Re-Coiling In-Salon Treatment

    Liter

    SKU 491447

    Bonus Offer
    Quick View
  • 109579 491445 491445 1 CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz. True devacurl/devagscurlbondconditioner12oz(1).jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Cream Conditioner with Patented CurlBond Complex re-coils damaged curls, softens, detangles, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Cream Conditioner

    Bonus Offer
    View Sizes
  • 109473 491443 491443 1 CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. True devacurl/devagscurlbondcleanser12oz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Mild Lather Cleanser

    Bonus Offer
    View Sizes
  • 109589 491448 491448 1 CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz. True devacurl/devacurlcurlbond8floz.jpg Bonus Deal Available 24.45 24.45 24.45 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Treatment Mask is a rich, reparative mask with Patented CURLBOND Complex re-coils damaged curls, conditions, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Treatment Mask

    Bonus Offer
    View Sizes
  • 109614 491412 491412 1 HEAVEN IN HAIR Moisturizing Deep Conditioner 8 Fl. Oz. DevaCurl DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner 8 Fl. Oz. True devacurl/devacurlheaveninhair8oz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required 0 DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner is designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner 8 Fl. Oz.

    DevaCurl
    HEAVEN IN HAIR Moisturizing Deep Conditioner

    Bonus Offer
    View Sizes
  • 109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler

    Bonus Offer
    View Sizes
  • 109500 491401 491401 1 LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz. True devacurl/devagslowpoooriginal12oz(1).jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture is designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz.

    DevaCurl
    LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture

    Bonus Offer
    View Sizes
  • 109619 491433 491433 1 MELT INTO MOISTURE Treatment Mask 8 Fl. Oz. DevaCurl DevaCurl MELT INTO MOISTURE Treatment Mask 8 Fl. Oz. True devacurl/devagsmeltintomoisture8oz.jpg Bonus Deal Available 24.45 24.45 24.45 False False False False 0.00 False False Diversion contract is required 0 DevaCurl MELT INTO MOISTURE Treatment Mask is a great weekly treat for your curls. True Log in to view pricing! False
    DevaCurl MELT INTO MOISTURE Treatment Mask 8 Fl. Oz.

    DevaCurl
    MELT INTO MOISTURE Treatment Mask

    Bonus Offer
    View Sizes
  • 142279 491490 491490 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 22.25 22.25 22.25 False False False False 0.00 False False Diversion contract is required 0 DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False
    DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz.

    DevaCurl
    MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

    Bonus Offer
    View Sizes
  • 109484 491464 491464 1 NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoodecadence12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture is designed for dry coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz.

    DevaCurl
    NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture

    Bonus Offer
    View Sizes
  • 109530 491403 491403 1 NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoooriginal12oz(1).jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz.

    DevaCurl
    NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

    Bonus Offer
    View Sizes
  • 109603 491466 491466 1 ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsoneconditiondecadence12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner designed for dry, coarse curls. True Log in to view pricing! False
    DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 12 Fl. Oz.

    DevaCurl
    ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner

    Bonus Offer
    View Sizes
  • 109636 491406 491406 1 ONE CONDITION ORIGINAL Rich Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl ONE CONDITION ORIGINAL Rich Cream Conditioner 12 Fl. Oz. True devacurl/devagsoneconditionoriginal12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ONE CONDITION ORIGINAL Rich Creamy Conditioner is designed for dry, medium to Coarse Curls with olive oil and nourishing botanicals. True Log in to view pricing! False
    DevaCurl ONE CONDITION ORIGINAL Rich Cream Conditioner 12 Fl. Oz.

    DevaCurl
    ONE CONDITION ORIGINAL Rich Cream Conditioner

    Bonus Offer
    View Sizes
  • 109742 491415 491415 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False
    DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz.

    DevaCurl
    PLUMPING PRIMER Body-Building Gelée

    Bonus Offer
    View Sizes
(55 Items)