Schwarzkopf Royal Caravan Event1

devacurl

(32 Items)
  • 109579 491445 491445 1 CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz. True devacurl/devagscurlbondconditioner12oz(1).jpg 13.00 13.00 13.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Cream Conditioner with Patented CurlBond Complex re-coils damaged curls, softens, detangles, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz.

    DevaCurl CURLBOND Re-Coiling Cream Conditioner

    View Sizes
  • 109589 491448 491448 1 CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz. True devacurl/devagscurlbondmask8oz.jpg 18.00 18.00 18.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Treatment Mask is a rich, reparative mask with Patented CURLBOND Complex re-coils damaged curls, conditions, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz.

    DevaCurl CURLBOND Re-Coiling Treatment Mask

    View Sizes
  • 109617 491413 491413 1 HEAVEN IN HAIR Moisturizing Deep Conditioner 17.75 Fl. Oz. DevaCurl DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner 17.75 Fl. Oz. False devacurl/devacurlheaveninhair1775oz.jpg 24.00 24.00 20.40 True True Valid Thru 07/31/21 False 20.40 False False Diversion contract is required 0 DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner is designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner 17.75 Fl. Oz.

    DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner

    17.75 Fl. Oz.

    SKU 491413

    Promotional ItemLog in to view pricing!
    Quick View
  • 109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler

    View Sizes
  • 109516 491460 491460 1 LOW-POO DELIGHT Mild Lather Cleanser For Lightweight Moisture 12 Fl. Oz. DevaCurl DevaCurl LOW-POO DELIGHT Mild Lather Cleanser For Lightweight Moisture 12 Fl. Oz. True devacurl/devagslowpoodelight12oz.jpg 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl LOW-POO DELIGHT Mild Lather Cleanser For Lightweight Moisture designed for dry, fine curls. True Log in to view pricing! False
    DevaCurl LOW-POO DELIGHT Mild Lather Cleanser For Lightweight Moisture 12 Fl. Oz.

    DevaCurl LOW-POO DELIGHT Mild Lather Cleanser For Lightweight Moisture

    View Sizes
  • 109500 491401 491401 1 LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz. True devacurl/devagslowpoooriginal12oz(1).jpg 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture is designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz.

    DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture

    View Sizes
  • 109619 491433 491433 1 MELT INTO MOISTURE Treatment Mask 8 Fl. Oz. DevaCurl DevaCurl MELT INTO MOISTURE Treatment Mask 8 Fl. Oz. True devacurl/devagsmeltintomoisture8oz.jpg 18.00 18.00 18.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl MELT INTO MOISTURE Treatment Mask is a great weekly treat for your curls. True Log in to view pricing! False
    DevaCurl MELT INTO MOISTURE Treatment Mask 8 Fl. Oz.

    DevaCurl MELT INTO MOISTURE Treatment Mask

    View Sizes
  • 109484 491464 491464 1 NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoodecadence12oz.jpg 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture is designed for dry coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz.

    DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture

    View Sizes
  • 109530 491403 491403 1 NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoooriginal12oz(1).jpg 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz.

    DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

    View Sizes
  • 109659 491462 491462 1 ONE CONDITION DELIGHT Lightweight Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl ONE CONDITION DELIGHT Lightweight Cream Conditioner 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsoneconditiondelight12oz.jpg 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl ONE CONDITION DELIGHT Lightweight Cream Conditioner is made specifically for wavy hair. True Log in to view pricing! False
    DevaCurl ONE CONDITION DELIGHT Lightweight Cream Conditioner 12 Fl. Oz.

    DevaCurl ONE CONDITION DELIGHT Lightweight Cream Conditioner

    View Sizes
  • 109742 491415 491415 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg 10.00 10.00 10.00 False False False 0.00 False False Diversion contract is required 0 PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False
    DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz.

    DevaCurl PLUMPING PRIMER Body-Building Gelée

    View Sizes
  • 109756 491424 491424 1 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupremedefininggel12oz.jpg 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler previousl Arc AnGel Gel provides definition without the crunch. True Log in to view pricing! False
    DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler

    View Sizes
  • 109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False
    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler

    View Sizes
  • 109675 491435 491435 1 WASH DAY WONDER Time-Saving Slip Detangler 12 Fl. Oz. DevaCurl DevaCurl WASH DAY WONDER Time-Saving Slip Detangler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagswashdaywonder12oz.jpg 14.00 14.00 14.00 False False False 0.00 False False Diversion contract is required 0 DevaCurl WASH DAY WONDER Time-Saving Slip Detangler is a slip-enhancing formula with Tangle-Release Complex melts away tangles to ease wash day and styling so tangle-prone curls are softer and more manageable. True Log in to view pricing! False
    DevaCurl WASH DAY WONDER Time-Saving Slip Detangler 12 Fl. Oz.

    DevaCurl WASH DAY WONDER Time-Saving Slip Detangler

    View Sizes
  • 120640 491447P 491447P 1 Repair & Bond Salon Offer 5 pc. DevaCurl DevaCurl Repair & Bond Salon Offer 5 pc. False devacurl/ja21devacurlrepairbondsalonoffer.jpg 84.00 84.00 84.00 False True False 0.00 False False Diversion contract is required 0 DevaCurl Repair & Bond Salon Offer includes shampoo, conditioner, mask, and treatment.
    Purchase:
    1 CURLBOND Re-Coiling Mild Lather Cleanser Liter
    1 CURLBOND Re-Coiling Cream Conditioner Liter
    2 CURLBOND Re-Coiling Treatment Mask 8 oz.
    Receive FREE:
    1 CURLBOND PRO BOOST Re-Coiling In-Salon Treatment Liter
    True Log in to view pricing! False
    DevaCurl Repair & Bond Salon Offer 5 pc.

    DevaCurl Repair & Bond Salon Offer

    5 pc.

    SKU 491447P

    Promotional ItemLog in to view pricing!
    Quick View
(32 Items)