devacurl

(64 Items)
  • 97711 491341 491341 1 DevaTwist DevaCurl DevaCurl DevaTwist False devacurl/devacurldevatwisttowel.jpg Bonus Deal Available 17.20 17.20 17.20 False False False False 0.00 False False Diversion contract is required Share the hands-free, frizz-fighting, multitasking way to dry curls with your clients with the DevaTwist. True Log in to view pricing! False
    DevaCurl DevaTwist

    DevaCurl
    DevaTwist

    SKU 491341

    Bonus Offer
    Quick View
  • 122872 491473 491473 1 Fragrance-Free & Hypoallergenic NO-POO ORIGINAL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic NO-POO ORIGINAL 12 Fl. Oz. False devacurl/devacurlfragrancefreenopooorigina12floz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl Fragrance-Free NO-POO ORIGINAL's preserving blend will leave dry, medium to coarse curls shiny, bouncy and hydrated. True Log in to view pricing! False
    DevaCurl Fragrance-Free & Hypoallergenic NO-POO ORIGINAL 12 Fl. Oz.

    DevaCurl
    Fragrance-Free & Hypoallergenic NO-POO ORIGINAL

    12 Fl. Oz.

    SKU 491473

    Bonus Offer
    Quick View
  • 21928 491209 491209 1 DevaTowel 20 inch x 39 inch DevaCurl DevaCurl DevaTowel 20 inch x 39 inch False devacurl/devacurl_devatowel_group_b.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required DevaCurl DevaTowel is a smooth, microfiber texture towel that helps absorb excess moisture and enhances curl shape without roughing them up so your curls dry with more definition and less frizz. True Log in to view pricing! False
    DevaCurl DevaTowel 20 inch x 39 inch

    DevaCurl
    DevaTowel

    20 inch x 39 inch

    SKU 491209

    Bonus Offer
    Quick View
  • 109769 491429 491429 1 WAVE MAKER Lightweight Moisturizing Definer 5 Fl. Oz. DevaCurl DevaCurl WAVE MAKER Lightweight Moisturizing Definer 5 Fl. Oz. False devacurl/devacurlnewpackagingdevagswavemaker5oz.jpg Bonus Deal Available 18.89 18.89 18.89 False False False False 0.00 False False Diversion contract is required DevaCurl WAVE MAKER Lightweight Moisturizing Definer is a lightweight cream with a hydra-definition blend that provides fine curls with shape and frizz control. True Log in to view pricing! False
    DevaCurl WAVE MAKER Lightweight Moisturizing Definer 5 Fl. Oz.

    DevaCurl
    WAVE MAKER Lightweight Moisturizing Definer

    5 Fl. Oz.

    SKU 491429

    Bonus Offer
    Quick View
  • 109764 491419 491419 1 SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz. DevaCurl DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz. False devacurl/devacurlnewpackagingdevagssupermousse5oz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer gives curls day 3 volume on day 1 with enhanced bounce, shine, and a soft, no-crunch finish. Humidity-resistant formula reduces frizz and flyaways as well. True Log in to view pricing! False
    DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz.

    DevaCurl
    SUPERMOUSSE Coconut Oil Infused Volumizer

    5 Fl. Oz.

    SKU 491419

    Bonus Offer
    Quick View
  • 109473 491444 491444 1 CURLBOND Re-Coiling Mild Lather Cleanser Liter DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser Liter True devacurl/devagscurlbondcleanser32oz.jpg Bonus Deal Available 34.45 34.45 27.56 True False False False 27.56 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser Liter

    DevaCurl
    CURLBOND Re-Coiling Mild Lather Cleanser

    Bonus Offer
    View Sizes
  • 122874 491474 491474 1 Fragrance-Free & Hypoallergenic ONE CONDITION ORIGINAL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ONE CONDITION ORIGINAL 12 Fl. Oz. False devacurl/devacurlfragrancefreeoneconditionoriginal12floz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl Fragrance-Free & Hypoallergenic ONE CONDITION ORIGINAL has moisture preserving blends that help fight tangles, control frizz and leave dry, medium to coarse curls feeling nourished, soft and bouncy. True Log in to view pricing! False
    DevaCurl Fragrance-Free & Hypoallergenic ONE CONDITION ORIGINAL 12 Fl. Oz.

    DevaCurl
    Fragrance-Free & Hypoallergenic ONE CONDITION ORIGINAL

    12 Fl. Oz.

    SKU 491474

    Bonus Offer
    Quick View
  • 109589 491449 491449 1 CURLBOND Re-Coiling Treatment Mask 17.75 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Treatment Mask 17.75 Fl. Oz. True devacurl/devagscurlbondmask1775oz.jpg Bonus Deal Available 43.35 43.35 43.35 False False False False 0.00 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Treatment Mask is a rich, reparative mask with Patented CURLBOND Complex re-coils damaged curls, conditions, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Treatment Mask 17.75 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Treatment Mask

    Bonus Offer
    View Sizes
  • 109733 491421 491421 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter True devacurl/devacurlnewpackagingdevagslightdefininggel32oz.jpg Bonus Deal Available 32.20 32.20 25.76 True False False False 25.76 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler

    Bonus Offer
    View Sizes
  • 109765 491423 491423 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter True devacurl/devacurlnewpackagingdevagsultradefininggel32oz.jpg Bonus Deal Available 32.20 32.20 25.76 True False False False 25.76 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False
    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter

    DevaCurl
    ULTRA DEFINING GEL Strong Hold No-Crunch Styler

    Bonus Offer
    View Sizes
  • 109765 491452 491452 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 3 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 3 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel3oz.jpg Bonus Deal Available 7.75 7.75 7.75 False False False False 0.00 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False
    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 3 Fl. Oz.

    DevaCurl
    ULTRA DEFINING GEL Strong Hold No-Crunch Styler

    Bonus Offer
    View Sizes
  • 109601 491468 491468 1 LEAVE-IN DECADENCE Moisturizing Leave-In Conditioner 8 Fl. Oz. DevaCurl DevaCurl LEAVE-IN DECADENCE Moisturizing Leave-In Conditioner 8 Fl. Oz. False devacurl/devagsleaveindecadence8oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl LEAVE-IN DECADENCE Moisturizing Leave-In Conditioner is designed for dry, coarse curls. True Log in to view pricing! False
    DevaCurl LEAVE-IN DECADENCE Moisturizing Leave-In Conditioner 8 Fl. Oz.

    DevaCurl
    LEAVE-IN DECADENCE Moisturizing Leave-In Conditioner

    8 Fl. Oz.

    SKU 491468

    Bonus Offer
    Quick View
  • 109530 491404 491404 1 NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture Liter DevaCurl DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture Liter True devacurl/devagsnopoooriginal32oz.jpg Bonus Deal Available 32.20 32.20 25.76 True False False False 25.76 False False Diversion contract is required DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture Liter

    DevaCurl
    NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

    Bonus Offer
    View Sizes
  • 109579 491446 491446 1 CURLBOND Re-Coiling Cream Conditioner Liter DevaCurl DevaCurl CURLBOND Re-Coiling Cream Conditioner Liter True devacurl/devagscurlbondconditioner32oz.jpg Bonus Deal Available 34.45 34.45 27.56 True False False False 27.56 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Cream Conditioner with Patented CurlBond Complex re-coils damaged curls, softens, detangles, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Cream Conditioner Liter

    DevaCurl
    CURLBOND Re-Coiling Cream Conditioner

    Bonus Offer
    View Sizes
  • 109742 491415 491415 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. False devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False
    DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz.

    DevaCurl
    PLUMPING PRIMER Body-Building Gelée

    5 Fl. Oz.

    SKU 491415

    Bonus Offer
    Quick View
(64 Items)