devacurl

(19 Items)
  • 165625 491402P 491402P 1 Large Intro DevaCurl DevaCurl Large Intro False devacurl/devacurllargeintro46pc.jpg Bonus Deal Available 999.00 999.00 999.00 False True False False 0.00 False False Diversion contract is required DevaCurl Large Intro includes shampoo, conditioner, mask, serum, treatment, leave-in, a variety of styling products, towel, dryer, dryer attachment, and education. True Log in to view pricing! False
    DevaCurl Large Intro

    DevaCurl
    Large Intro

    SKU 491402P

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 165626 491401P 491401P 1 Small Intro DevaCurl DevaCurl Small Intro False devacurl/devacurlsmallintro27pc.jpg Bonus Deal Available 475.00 475.00 475.00 False True False False 0.00 False False Diversion contract is required DevaCurl Small Intro includes shampoo, conditioner, mask, serum, treatment, a variety of styling products, towel, dryer attachment, and education. True Log in to view pricing! False
    DevaCurl Small Intro

    DevaCurl
    Small Intro

    SKU 491401P

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 165627 491400P 491400P 1 Starter Kit DevaCurl DevaCurl Starter Kit False devacurl/devacurlstarterkit8pc.jpg Bonus Deal Available 99.00 99.00 99.00 False True False False 0.00 False False Diversion contract is required DevaCurl Starter Kit includes shampoo, conditioner, gel, cream, leave-in, foam, and education. True Log in to view pricing! False
    DevaCurl Starter Kit

    DevaCurl
    Starter Kit

    SKU 491400P

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 135792 491483 491483 1 DEVAFAST DRY Accelerator Spray 6 Fl. Oz. DevaCurl DevaCurl DEVAFAST DRY Accelerator Spray 6 Fl. Oz. False devacurl/devacurldevafastdrydryacceleratorspray6oz.jpg Bonus Deal Available 16.65 16.65 16.65 False False False False 0.00 False False Diversion contract is required Speed up your air-dry & diffusing time up to 66% with Devacurl's DEVAFAST DRY Accelerator Spray! This lightweight dry accelerating spray helps accelerate the rate at which water evaporates from the hair's surface. True Log in to view pricing! False
    DevaCurl DEVAFAST DRY Accelerator Spray 6 Fl. Oz.

    DevaCurl
    DEVAFAST DRY Accelerator Spray

    6 Fl. Oz.

    SKU 491483

    Bonus Offer
    Quick View
  • 109682 491414 491414 1 DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. DevaCurl DevaCurl DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. False devacurl/devacurldevafresh.jpg Bonus Deal Available 12.25 12.25 12.25 False False False False 0.00 False False Diversion contract is required DevaCurl DEVAFRESH Scalp & Hair Revitalizer is a style-extending spray with the Time Released Freshness Complex that maintains moisture, reduces frizz, and provides 48 hour odor control and a cooling scalp sensation. True Log in to view pricing! False
    DevaCurl DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz.

    DevaCurl
    DEVAFRESH Scalp & Hair Revitalizer

    3 Fl. Oz.

    SKU 491414

    Bonus Offer
    Quick View
  • 109721 491417 491417 1 FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. DevaCurl DevaCurl FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. False devacurl/devagsflexfactor8oz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required DevaCurl FLEXFACTOR Curl Protection & Retention Primer is a heat and UV protective spray with the Curl Memory Complex protects from breakage from friction. True Log in to view pricing! False
    DevaCurl FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz.

    DevaCurl
    FLEXFACTOR Curl Protection & Retention Primer

    8 Fl. Oz.

    SKU 491417

    Bonus Offer
    Quick View
  • 109679 491432 491432 1 FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. DevaCurl DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. False devacurl/devacurlflexibleholdhairspray.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler is a flexible hold hairspray. True Log in to view pricing! False
    DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz.

    DevaCurl
    FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

    10 Fl. Oz.

    SKU 491432

    Bonus Offer
    Quick View
  • 109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler

    Bonus Offer
    View Sizes
  • 142279 491490 491490 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 22.25 22.25 22.25 False False False False 0.00 False False Diversion contract is required DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False
    DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz.

    DevaCurl
    MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

    Bonus Offer
    View Sizes
  • 109741 491431 491431 1 MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. DevaCurl DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsmoistureseal8oz.jpg Bonus Deal Available 16.65 16.65 16.65 False False False False 0.00 False False Diversion contract is required DevaCurl MOISTURE SEAL Hydrating Finishing Spray previously SET IT FREE, is a lightweight formula with a moisture locking blend brings much-needed hydration to dry curls helping to fight frizz and provide softness and shine. True Log in to view pricing! False
    DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz.

    DevaCurl
    MOISTURE SEAL Hydrating Finishing Spray

    8 Fl. Oz.

    SKU 491431

    Bonus Offer
    Quick View
  • 109742 491415 491415 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. False devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False
    DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz.

    DevaCurl
    PLUMPING PRIMER Body-Building Gelée

    5 Fl. Oz.

    SKU 491415

    Bonus Offer
    Quick View
  • 171889 491500 491500 1 QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 12 Fl. Oz. False devacurl/devacurlquenchn_definegel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler locks in moisture, enhances shine, provides curl definition, and controls frizz without crunch or flaking! True Log in to view pricing! False
    DevaCurl QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 12 Fl. Oz.

    DevaCurl
    QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler

    12 Fl. Oz.

    SKU 491500

    Bonus Offer
    Quick View
  • 109666 491438 491438 1 SCALP D(pH)ENSE Daily Nourishing & Protecting Serum 1 Fl. Oz. DevaCurl DevaCurl SCALP D(pH)ENSE Daily Nourishing & Protecting Serum 1 Fl. Oz. False devacurl/devacurlnewpackagingdevagsscalpdphense1oz.jpg Bonus Deal Available 21.65 21.65 21.65 False False False False 0.00 False False Diversion contract is required DevaCurl SCALP D(pH)ENSE Daily Nourishing & Protecting Serum is a non-oily, nourishing serum with Scalp Re-Balancing Complex to moisturize dry scalp. True Log in to view pricing! False
    DevaCurl SCALP D(pH)ENSE Daily Nourishing & Protecting Serum 1 Fl. Oz.

    DevaCurl
    SCALP D(pH)ENSE Daily Nourishing & Protecting Serum

    1 Fl. Oz.

    SKU 491438

    Bonus Offer
    Quick View
  • 109669 491437 491437 1 SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray 8 Fl. Oz. DevaCurl DevaCurl SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray 8 Fl. Oz. False devacurl/devascalppuriphydailynourishing8oz.jpg Bonus Deal Available 22.75 22.75 22.75 False False False False 0.00 False False Diversion contract is required DevaCurl SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray gently removes scalp buildup. True Log in to view pricing! False
    DevaCurl SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray 8 Fl. Oz.

    DevaCurl
    SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray

    8 Fl. Oz.

    SKU 491437

    Bonus Offer
    Quick View
  • 109745 491426 491426 1 STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. DevaCurl DevaCurl STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. True devacurl/devacurlnewpackagingdevacurlstylingcream51oz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required DevaCurl STYLING CREAM Touchable Moisturizing Definer is a rich cream with a hydra-definition blend provides medium to coarse curls with shape, frizz control, and a no-crunch finish. True Log in to view pricing! False
    DevaCurl STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz.

    DevaCurl
    STYLING CREAM Touchable Moisturizing Definer

    Bonus Offer
    View Sizes
(19 Items)