devacurl style & shape

152686 491496 491496 1 CURLHEIGHTS Volume + Body Boost Cream 6 Fl. Oz. DevaCurl DevaCurl CURLHEIGHTS Volume + Body Boost Cream 6 Fl. Oz. False devacurl/devacurlheightscream.jpg 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLHEIGHTS Volume + Body Boost Cream is a multitasking cream with Volume Complex that increases volume 2X to roots and reduces frizz by 83% up to 8 hrs*; defining and leaving curls with more body and fullness.

*When used as a collection. True Log in to view pricing! False

DevaCurl
CURLHEIGHTS Volume + Body Boost Cream

6 Fl. Oz.

SKU 491496

Log in to view pricing!

Quick View

135792 491483 491483 1 DEVAFAST DRY Accelerator Spray 6 Fl. Oz. DevaCurl DevaCurl DEVAFAST DRY Accelerator Spray 6 Fl. Oz. False devacurl/devacurldevafastdrydryacceleratorspray6oz.jpg 16.65 16.65 16.65 False False False False 0.00 False False Diversion contract is required 0 Speed up your air-dry & diffusing time up to 66% with Devacurl's DEVAFAST DRY Accelerator Spray! This lightweight dry accelerating spray helps accelerate the rate at which water evaporates from the hair's surface. True Log in to view pricing! False

DevaCurl
DEVAFAST DRY Accelerator Spray

6 Fl. Oz.

SKU 491483

Log in to view pricing!

Quick View

109682 491414 491414 1 DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. DevaCurl DevaCurl DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. False devacurl/devacurldevafresh.jpg 12.25 12.25 12.25 False False False False 0.00 False False Diversion contract is required 0 DevaCurl DEVAFRESH Scalp & Hair Revitalizer is a style-extending spray with the Time Released Freshness Complex that maintains moisture, reduces frizz, and provides 48 hour odor control and a cooling scalp sensation. True Log in to view pricing! False

DevaCurl
DEVAFRESH Scalp & Hair Revitalizer

3 Fl. Oz.

SKU 491414

Log in to view pricing!

Quick View

109721 491417 491417 1 FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. DevaCurl DevaCurl FLEXFACTOR Curl Protection & Retention Primer 8 Fl. Oz. False devacurl/devagsflexfactor8oz.jpg 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required 0 DevaCurl FLEXFACTOR Curl Protection & Retention Primer is a heat and UV protective spray with the Curl Memory Complex protects from breakage from friction. True Log in to view pricing! False

DevaCurl
FLEXFACTOR Curl Protection & Retention Primer

8 Fl. Oz.

SKU 491417

Log in to view pricing!

Quick View

109679 491432 491432 1 FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. DevaCurl DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. False devacurl/devacurlflexibleholdhairspray.jpg 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler is a flexible hold hairspray. True Log in to view pricing! False

DevaCurl
FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

10 Fl. Oz.

SKU 491432

Log in to view pricing!

Quick View

122879 491476 491476 1 Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicsupercream51floz.jpg 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM's hydra-definition blend provides coarse curls with smoothness, shape, shine and frizz control. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic SUPERCREAM

5.1 Fl. Oz.

SKU 491476

Log in to view pricing!

Quick View

122877 491475 491475 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

12 Fl. Oz.

SKU 491475

Log in to view pricing!

Quick View

109723 491418 491418 1 FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster 8 Fl. Oz. DevaCurl DevaCurl FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsfrizzfightingvolumizingfoam8oz.jpg 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required 0 DevaCurl FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster gives your curls a body boost! True Log in to view pricing! False

DevaCurl
FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster

8 Fl. Oz.

SKU 491418

Log in to view pricing!

Quick View

109731 491430 491430 1 HIGH SHINE Anti-Frizz Nourishing Oil 1.7 Fl. Oz. DevaCurl DevaCurl HIGH SHINE Anti-Frizz Nourishing Oil 1.7 Fl. Oz. False devacurl/devacurlnewpackagingdevagshighshine17oz.jpg 16.10 16.10 16.10 False False False False 0.00 False False Diversion contract is required 0 DevaCurl HIGH SHINE Anti-Frizz Nourishing Oil is a shine-enhancing, frizz-fighting gem is specially formulated for curls! True Log in to view pricing! False

DevaCurl
HIGH SHINE Anti-Frizz Nourishing Oil

1.7 Fl. Oz.

SKU 491430

Log in to view pricing!

Quick View

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Log in to view pricing!

View Sizes

142279 491490 491490 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg 22.25 22.25 22.25 False False False False 0.00 False False Diversion contract is required 0 DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

Log in to view pricing!

View Sizes

109741 491431 491431 1 MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. DevaCurl DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsmoistureseal8oz.jpg 16.65 16.65 16.65 False False False False 0.00 False False Diversion contract is required 0 DevaCurl MOISTURE SEAL Hydrating Finishing Spray previously SET IT FREE, is a lightweight formula with a moisture locking blend brings much-needed hydration to dry curls helping to fight frizz and provide softness and shine. True Log in to view pricing! False

DevaCurl
MOISTURE SEAL Hydrating Finishing Spray

8 Fl. Oz.

SKU 491431

Log in to view pricing!

Quick View

109742 491415 491415 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

DevaCurl
PLUMPING PRIMER Body-Building Gelée

Log in to view pricing!

View Sizes

109745 491426 491426 1 STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. DevaCurl DevaCurl STYLING CREAM Touchable Moisturizing Definer 5.1 Fl. Oz. True devacurl/devacurlnewpackagingdevacurlstylingcream51oz.jpg 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required 0 DevaCurl STYLING CREAM Touchable Moisturizing Definer is a rich cream with a hydra-definition blend provides medium to coarse curls with shape, frizz control, and a no-crunch finish. True Log in to view pricing! False

DevaCurl
STYLING CREAM Touchable Moisturizing Definer

Log in to view pricing!

View Sizes

160033 491499 491499 1 SUPERCREAM Rich Coconut-Infused Definer 3 Fl. Oz. DevaCurl DevaCurl SUPERCREAM Rich Coconut-Infused Definer 3 Fl. Oz. False devacurl/devacurlsupercream3oz.jpg 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl SUPERCREAM Rich Coconut-Infused Definer is a multitasking, ultra-rich cream with a hydra-definition blend that provides coarse curls with smoothness, shape, shine, and frizz control. True Log in to view pricing! False

DevaCurl
SUPERCREAM Rich Coconut-Infused Definer

3 Fl. Oz.

SKU 491499

Log in to view pricing!

Quick View

DevaCurl
CURLHEIGHTS Volume + Body Boost Cream

DevaCurl
DEVAFAST DRY Accelerator Spray

DevaCurl
DEVAFRESH Scalp & Hair Revitalizer

DevaCurl
FLEXFACTOR Curl Protection & Retention Primer

DevaCurl
FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

DevaCurl
Fragrance-Free & Hypoallergenic SUPERCREAM

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

DevaCurl
FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster

DevaCurl
HIGH SHINE Anti-Frizz Nourishing Oil

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

DevaCurl
MOISTURE SEAL Hydrating Finishing Spray

DevaCurl
PLUMPING PRIMER Body-Building Gelée

DevaCurl
STYLING CREAM Touchable Moisturizing Definer

DevaCurl
SUPERCREAM Rich Coconut-Infused Definer

As Seen on Instagram

Volume Pricing

Product Pack

devacurl style & shape

DevaCurlCURLHEIGHTS Volume + Body Boost Cream

DevaCurlDEVAFAST DRY Accelerator Spray

DevaCurlDEVAFRESH Scalp & Hair Revitalizer

DevaCurlFLEXFACTOR Curl Protection & Retention Primer

DevaCurlFLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

DevaCurlFragrance-Free & Hypoallergenic SUPERCREAM

DevaCurlFragrance-Free & Hypoallergenic ULTRA DEFINING GEL

DevaCurlFRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster

DevaCurlHIGH SHINE Anti-Frizz Nourishing Oil

DevaCurlLIGHT DEFINING GEL Soft Hold No-Crunch Styler

DevaCurlMIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

DevaCurlMOISTURE SEAL Hydrating Finishing Spray

DevaCurlPLUMPING PRIMER Body-Building Gelée

DevaCurlSTYLING CREAM Touchable Moisturizing Definer

DevaCurlSUPERCREAM Rich Coconut-Infused Definer

As Seen on Instagram

Processing Your Request

DevaCurl
CURLHEIGHTS Volume + Body Boost Cream

DevaCurl
DEVAFAST DRY Accelerator Spray

DevaCurl
DEVAFRESH Scalp & Hair Revitalizer

DevaCurl
FLEXFACTOR Curl Protection & Retention Primer

DevaCurl
FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

DevaCurl
Fragrance-Free & Hypoallergenic SUPERCREAM

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

DevaCurl
FRIZZ-FIGHTING VOLUMIZING FOAM Lightweight Body Booster

DevaCurl
HIGH SHINE Anti-Frizz Nourishing Oil

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

DevaCurl
MOISTURE SEAL Hydrating Finishing Spray

DevaCurl
PLUMPING PRIMER Body-Building Gelée

DevaCurl
STYLING CREAM Touchable Moisturizing Definer

DevaCurl
SUPERCREAM Rich Coconut-Infused Definer