styling gel

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 15.55 15.55 15.55 False False False False 0.00 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 15.55 15.55 10.00 True False False False 10.00 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

175338 496004 496004 1 Gel++ 12 Fl. Oz. CURL CLINIC+ CURL CLINIC+ Gel++ 12 Fl. Oz. True curlclinic/curlclinicplusgel12oz.jpg Bonus Deal Available 22.00 22.00 22.00 False False False False 0.00 False False Diversion contract is required CURL CLINIC+ Gel++ delivers long-lasting hold and definition while locking in moisture and protecting curls from frizz. True Log in to view pricing! False

CURL CLINIC+
Gel++

Log in to view pricing!

View Sizes

22981 251396 251396 1 This is a Medium Hold Modeling Gel 8.45 Fl. Oz. Davines Davines More Inside This is a Medium Hold Modeling Gel 8.45 Fl. Oz. False davines/davinesmoreinsidemodelinggel845floz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This Is A Medium Hold Modeling Gel gives body an elasticity to curls, dries quickly, and eliminates frizz. True Log in to view pricing! False

Davines
More Inside This is a Medium Hold Modeling Gel

8.45 Fl. Oz.

SKU 251396

Log in to view pricing!

Quick View

20829 251395 251395 1 This is a Strong Hold Cream Gel 4.22 Fl. Oz. Davines Davines More Inside This is a Strong Hold Cream Gel 4.22 Fl. Oz. False davines/davines_moreinside_strong-cream-gel_4.22oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This Is A Strong Hold Cream Gel is quick-drying, residue-free and workable. True Log in to view pricing! False

Davines
More Inside This is a Strong Hold Cream Gel

4.22 Fl. Oz.

SKU 251395

Log in to view pricing!

Quick View

171889 491500 491500 1 QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler 12 Fl. Oz. False devacurl/devacurlquenchn_definegel12oz.jpg Bonus Deal Available 15.55 15.55 15.55 False False False False 0.00 False False Diversion contract is required DevaCurl QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler locks in moisture, enhances shine, provides curl definition, and controls frizz without crunch or flaking! True Log in to view pricing! False

DevaCurl
QUENCH'N DEFINE GEL Strong Hold Non-Crunch Styler

12 Fl. Oz.

SKU 491500

Log in to view pricing!

Quick View

171133 988731 988731 1 Define Me Gel 5.1 Fl. Oz. Framesi Framesi FOR-ME Define Me Gel 5.1 Fl. Oz. False framesi/framesiformedefinemegel.jpg Bonus Deal Available 11.05 11.05 11.05 False False False False 0.00 False False Diversion contract is required Framesi FOR-ME Define Me Gel is a versatile styling gel designed for strong, precise hold and defined styling. True Log in to view pricing! False

Framesi
FOR-ME Define Me Gel

5.1 Fl. Oz.

SKU 988731

Log in to view pricing!

Quick View

161307 182619 182619 1 Curls Like Us Define & Seal Curl Defining Gelée 8.5 Fl. Oz. Joico Joico Curl Care Curls Like Us Define & Seal Curl Defining Gelée 8.5 Fl. Oz. False joico/joicocurlslikeusdefineandsealgelee.jpg Bonus Deal Available 14.45 14.45 14.45 False False False False 0.00 False False Diversion contract is required Keep your curls in formation with Joico Curls Like Us Define & Seal Curl Defining Gelée, the medium-hold gelée that won’t flake on you. True Log in to view pricing! False

Joico
Curl Care Curls Like Us Define & Seal Curl Defining Gelée

8.5 Fl. Oz.

SKU 182619

Log in to view pricing!

Quick View

162727 486060 486060 1 SPRING LOADED 6.8 Fl. Oz. Keune Keune SPRING LOADED 6.8 Fl. Oz. False keune/keunespringloaded5.1oz.jpg Bonus Deal Available 13.25 13.25 13.25 False False False False 0.00 False False Diversion contract is required Load, nourish, and define curls with Keune's SPRING LOADED soft gel. True Log in to view pricing! False

Keune
SPRING LOADED

6.8 Fl. Oz.

SKU 486060

Log in to view pricing!

Quick View

176982 525025 525025 1 CURL CURL GEL 5 Fl. Oz. O&M O&M CURL CURL GEL 5 Fl. Oz. False om/oandmCCGELCurlCurlGel150ml1.jpg Bonus Deal Available 19.98 19.98 19.98 False False False False 0.00 False False Diversion contract is required O&M CURL CURL GEL delivers flexible hold to define curls while maintaining softness and movement. True Log in to view pricing! False

O&M
CURL CURL GEL

5 Fl. Oz.

SKU 525025

Log in to view pricing!

Quick View

153149 702914 702914 1 Curl Jam Defining Gel 10.1 Fl. Oz. Schwarzkopf Professional Schwarzkopf Professional OSiS+ Curl Jam Defining Gel 10.1 Fl. Oz. False schwarzkopf/osiscurljam10.1floz.jpg Bonus Deal Available 14.45 14.45 14.45 False False False False 0.00 False False Diversion contract is required Schwarzkopf OSiS+ Curl Jam Defining Gel defines natural curls and waves. True Log in to view pricing! False

Schwarzkopf Professional
OSiS+ Curl Jam Defining Gel

10.1 Fl. Oz.

SKU 702914

Log in to view pricing!

Quick View

153150 702915 702915 1 Tipsy Twirl Enhancing Jelly 10.1 Fl. Oz. Schwarzkopf Professional Schwarzkopf Professional OSiS+ Tipsy Twirl Enhancing Jelly 10.1 Fl. Oz. False schwarzkopf/osistipsytwirl10.1floz.jpg Bonus Deal Available 14.45 14.45 14.45 False False False False 0.00 False False Diversion contract is required Schwarzkopf OSiS+ Tipsy Twirl Enhancing Jelly is a texture-enhancing curl jelly that defines natural waves and curls. True Log in to view pricing! False

Schwarzkopf Professional
OSiS+ Tipsy Twirl Enhancing Jelly

10.1 Fl. Oz.

SKU 702915

Log in to view pricing!

Quick View

154595 499010 499010 1 Blow Dry Volumizing Gel 8.5 Fl. Oz. Sexy Hair Sexy Hair Blow Dry Volumizing Gel 8.5 Fl. Oz. False sexyhair/sexyhairbigblowdryvolumizing8.5oz.jpg Bonus Deal Available 10.98 10.98 10.98 False False False False 0.00 False False Diversion contract is required Sexy Hair Big Sexy Blow Dry Volumizing Gel breathes life into your hair with more volume and lift. True Log in to view pricing! False

Sexy Hair
Blow Dry Volumizing Gel

8.5 Fl. Oz.

SKU 499010

Log in to view pricing!

Quick View

154582 499007 499007 1 Hard Up Hard Holding Gel 5.1 Fl. Oz. Sexy Hair Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz. True sexyhair/sexyhairstylehardupgel5.1oz.jpg Bonus Deal Available 10.98 10.98 10.98 False False False False 0.00 False False Diversion contract is required Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a high hold finish and humidity resistance that lasts up to 72 hours. True Log in to view pricing! False

Sexy Hair
Hard Up Hard Holding Gel

Log in to view pricing!

View Sizes

156125 559221 559221 1 curl foaming gel 6.7 Fl. Oz. Verb Verb curl foaming gel 6.7 Fl. Oz. False verb/verbcurlfoaminggel6.7.jpg Bonus Deal Available 12.22 12.22 12.22 False False False False 0.00 False False Diversion contract is required Verb curl foaming gel adds frizz control, lightweight hold, and definition without stiffness. True Log in to view pricing! False

Verb
curl foaming gel

6.7 Fl. Oz.

SKU 559221

Log in to view pricing!

Quick View

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler