styling gel

(39 Items)

143038 795146 795146 1 MY WAY CURL DEFINING GEL 5 Fl. Oz. ALTERNA Professional ALTERNA Professional My Hair My Canvas MY WAY CURL DEFINING GEL 5 Fl. Oz. False alternaprofessional/alternamyhairmycanvasmywaycurldefininggel5oz.jpg Special Offer 15.00 15.00 10.00 True False False 10.00 False False Diversion contract is required 0 ALTERNA Professional My Hair My Canvas MY WAY CURL DEFINING GEL is a vegan and silicone-free curl defining gel that is non-greasy and non-flaking, providing a soft but flexible hold, and humidity resistance for up to 72-hours. True Log in to view pricing! False

ALTERNA Professional
My Hair My Canvas MY WAY CURL DEFINING GEL

5 Fl. Oz.

SKU 795146

On SaleLog in to view pricing!
Quick View
51968 298044 298044 1 curl corps enhancing gel 6.7 Fl. Oz. amika: amika: curl corps enhancing gel 6.7 Fl. Oz. False amika/amikacurlcorpsenhancinggel6oz.jpg Special Offer 13.95 13.95 13.95 False False False 0.00 False False Diversion contract is required 0 amika: curl corps enhancing gel is a weather-proofing, curl-boosting gel that gives bouncy shape without the crunch factor. True Log in to view pricing! False

amika:
curl corps enhancing gel

6.7 Fl. Oz.

SKU 298044

Log in to view pricing!
Quick View
565 988334 988334 1 Hydro Gel Light 5.1 Fl. Oz. Framesi BY framesi™ Hydro Gel Light 5.1 Fl. Oz. False framesi/738884262312.jpg Special Offer 7.73 7.73 7.73 False False False 0.00 False False Diversion contract is required 0 A styling and sculpting gel that creates natural, flexible hold while adding volume and shine. Will not build up and lets your color shine through. True Log in to view pricing! False

BY framesi™ Hydro Gel Light

5.1 Fl. Oz.

SKU 988334

Log in to view pricing!
Quick View
566 988335 988335 1 Hydro Gel Strong 5.1 Fl. Oz. Framesi BY framesi™ Hydro Gel Strong 5.1 Fl. Oz. False framesi/738884262329.jpg Special Offer 7.73 7.73 7.73 False False False 0.00 False False Diversion contract is required 0 A strong hold gel that fortifies hair, leaving no residue. Volumizes and enhances shine, lets your color shine through. True Log in to view pricing! False

BY framesi™ Hydro Gel Strong

5.1 Fl. Oz.

SKU 988335

Log in to view pricing!
Quick View
2638 528014 528014 1 Styling Gel 16 Fl. Oz. Clubman Clubman Styling Gel 16 Fl. Oz. False clubman/cl_jar_279200_stygel_hr.jpg Special Offer 8.00 8.00 8.00 False False False 0.00 False False Diversion contract is required 0 Specially formulated for me. True Log in to view pricing! False

Clubman
Styling Gel

16 Fl. Oz.

SKU 528014

Log in to view pricing!
Quick View
132746 252922 252922 1 This is a Curl Gel Oil 8.45 Fl. Oz. Davines Davines More Inside This is a Curl Gel Oil 8.45 Fl. Oz. False davines/davinesmoreinsidecurlgeloil8oz.jpg Special Offer 16.00 16.00 16.00 False False False 0.00 False True Diversion contract is required 0 Davines More Inside This is a Curl Gel Oil is formulated for extra-curly hair patterns and textures in mind. True Log in to view pricing! False

Davines
More Inside This is a Curl Gel Oil

8.45 Fl. Oz.

SKU 252922

Log in to view pricing!
Quick View
22981 251396 251396 1 This is a Medium Hold Modeling Gel 8.45 Fl. Oz. Davines Davines More Inside This is a Medium Hold Modeling Gel 8.45 Fl. Oz. False davines/davinesmoreinsidemodelinggel845floz.jpg Special Offer 15.00 15.00 15.00 False False False 0.00 False True Diversion contract is required 0 Davines More Inside This Is A Medium Hold Modeling Gel gives body an elasticity to curls, dries quickly, and eliminates frizz. True Log in to view pricing! False

Davines
More Inside This is a Medium Hold Modeling Gel

8.45 Fl. Oz.

SKU 251396

Log in to view pricing!
Quick View
20829 251395 251395 1 This is a Strong Hold Cream Gel 4.22 Fl. Oz. Davines Davines More Inside This is a Strong Hold Cream Gel 4.22 Fl. Oz. False davines/davinesmoreinsidestrongcreamgel422floz.png Special Offer 15.00 15.00 15.00 False False False 0.00 False True Diversion contract is required 0 Davines More Inside This Is A Strong Hold Cream Gel is quick-drying, residue-free and workable. True Log in to view pricing! False

Davines
More Inside This is a Strong Hold Cream Gel

4.22 Fl. Oz.

SKU 251395

Log in to view pricing!
Quick View
19809 251242 251242 1 Gel 5.07 Fl. Oz. Davines Davines NaturalTech Purifying Gel 5.07 Fl. Oz. False davines/purifyinggel.jpg Special Offer 18.00 18.00 18.00 False False False 0.00 False True Diversion contract is required 0 Davines NaturalTech Purifying Gel is an antifungal and antibacterial gel that keeps the scalp clean and healthy. True Log in to view pricing! False

Davines
NaturalTech Purifying Gel

5.07 Fl. Oz.

SKU 251242

Log in to view pricing!
Quick View
122877 491475 491475 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg Special Offer 17.80 17.80 17.80 False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

12 Fl. Oz.

SKU 491475

Log in to view pricing!
Quick View
109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Special Offer 17.80 17.80 17.80 False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Log in to view pricing!
View Sizes
109756 491424 491424 1 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupremedefininggel12oz.jpg Special Offer 17.80 17.80 17.80 False False False 0.00 False False Diversion contract is required 0 SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler previousl Arc AnGel Gel provides definition without the crunch. True Log in to view pricing! False

DevaCurl
SUPREME DEFINING GEL Super-Strong Hold No-Crunch Styler

Log in to view pricing!
View Sizes
109778 491439 491439 1 THE ESSENTIALS LIGHT MOISTURE KIT 4 pc. DevaCurl DevaCurl THE ESSENTIALS LIGHT MOISTURE KIT 4 pc. False devacurl/devacurlnewpackaginggskitdelight.jpg Special Offer 19.45 19.45 19.45 False False False 0.00 False False Diversion contract is required 0 THE ESSENTIALS LIGHT MOISTURE KIT includes LOW-POO DELIGHT, ONE CONDITION DELIGHT, WAVEMAKER, and ULTRA DEFINING GEL. Mini sizes. Maximum impact. Carefully curated for fine waves, curls, and coils. True Log in to view pricing! False

DevaCurl
THE ESSENTIALS LIGHT MOISTURE KIT

4 pc.

SKU 491439

Log in to view pricing!
Quick View
109776 491440 491440 1 THE ESSENTIALS RICH MOISTURE KIT 4 pc. DevaCurl DevaCurl THE ESSENTIALS RICH MOISTURE KIT 4 pc. False devacurl/devacurlnewpackaginggskitoriginal.jpg Special Offer 19.45 19.45 19.45 False False False 0.00 False False Diversion contract is required 0 DevaCurl THE ESSENTIALS RICH MOISTURE KIT includes NO-POO ORIGINAL, ONE CONDITION ORIGINAL, LIGHT DEFINING GEL, and STYLING CREAM. Mini sizes. Maximum impact. Carefully curated for medium waves, curls, and coils. True Log in to view pricing! False

DevaCurl
THE ESSENTIALS RICH MOISTURE KIT

4 pc.

SKU 491440

Log in to view pricing!
Quick View
109782 491441 491441 1 THE ESSENTIALS ULTRA-RICH MOISTURE KIT 4 pc. DevaCurl DevaCurl THE ESSENTIALS ULTRA-RICH MOISTURE KIT 4 pc. False devacurl/devacurlnewpackaginggskitdecadence.jpg Special Offer 19.45 19.45 19.45 False False False 0.00 False False Diversion contract is required 0 DevaCurl THE ESSENTIALS ULTRA-RICH MOISTURE KIT includes NO-POO DECADENCE, ONE CONDITION DECADENCE, ULTRA DEFINING GEL, AND SUPERCREAM. Mini sizes, Maximum impact. Carefully curated for coarse waves, curls, and coils. These cleanse, condition and style essentials will provide the foundation for healthy-looking curls. True Log in to view pricing! False

DevaCurl
THE ESSENTIALS ULTRA-RICH MOISTURE KIT

4 pc.

SKU 491441

Log in to view pricing!
Quick View