styling gel

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 13.35 True False False False 13.35 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 13.35 True False False False 13.35 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

154582 499007 499007 1 Hard Up Hard Holding Gel 5.1 Fl. Oz. Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz. True sexyhair/sexyhairstylehardupgel5.1oz.jpg Bonus Deal Available 10.98 10.98 8.50 True False False False 8.50 False False Diversion contract is required Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a maximum high hold finish and humidity resistance that lasts up to 48 hours. True Log in to view pricing! False

Hard Up Hard Holding Gel

On SaleLog in to view pricing!

View Sizes

132443 624467 624467 1 Curl Flex Memory Gel 6.8 Fl. Oz. L'ANZA L'ANZA ADVANCED HEALING CURLS Curl Flex Memory Gel 6.8 Fl. Oz. True lanza/lanzaadvancedhealingcurlscurlflexmemorygel6oz.jpg Bonus Deal Available 15.50 15.50 11.63 True False False False 11.63 False False Diversion contract is required L'ANZA ADVANCED HEALING CURLS Curl Flex Memory Gel gives strong support and hold with maximum curl retention. True Log in to view pricing! False

L'ANZA
ADVANCED HEALING CURLS Curl Flex Memory Gel

On SaleLog in to view pricing!

View Sizes

41635 624225 624225 1 Mega Gel 7.1 Fl. Oz. L'ANZA L'ANZA ADVANCED HEALING STYLE Mega Gel 7.1 Fl. Oz. False lanza/lanzahealingstylemegagel.jpg Bonus Deal Available 11.75 11.75 8.81 True False False False 8.81 False False Diversion contract is required L'ANZA ADVANCED HEALING STYLE Mega Gel is a multi-purpose styling gel with strong hold. True Log in to view pricing! False

L'ANZA
ADVANCED HEALING STYLE Mega Gel

7.1 Fl. Oz.

SKU 624225

On SaleLog in to view pricing!

Quick View

147266 498019 498019 1 GEL 5.07 Fl. Oz. STMNT STMNT GEL 5.07 Fl. Oz. False stmnt/stmntgel5oz.jpg Bonus Deal Available 10.98 10.98 9.00 True False False False 9.00 False False Diversion contract is required STMNT GEL is a classic hair gel with a statement-making twist thanks to its unique formula with charcoal for a satin finish without flakes. True Log in to view pricing! False

STMNT
GEL

5.07 Fl. Oz.

SKU 498019

On SaleLog in to view pricing!

Quick View

55477 595378 595378 1 Frozen Gel 5.3 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Frozen Gel 5.3 Fl. Oz. False alfaparfmilano/mj18alfaparffrozengel53floz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Style Stories Frozen Gel is a gel for extreme ice-effect looks. Crystallizes and sets the hair style. A perfect look for 8 hours! True Log in to view pricing! False

Alfaparf Milano
Style Stories Frozen Gel

5.3 Fl. Oz.

SKU 595378

Log in to view pricing!

Quick View

55471 595376 595376 1 Texturizing Gel 5.07 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Texturizing Gel 5.07 Fl. Oz. False alfaparfmilano/mj18alfaparftexturizinggel507floz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Style Stories Texturizing Gel brings structure to the hair fiber, for defined and malleable results with a natural effect. Suitable for all hair types, even to enhance natural drying. True Log in to view pricing! False

Alfaparf Milano
Style Stories Texturizing Gel

5.07 Fl. Oz.

SKU 595376

Log in to view pricing!

Quick View

51968 298044 298044 1 curl corps enhancing gel 6.7 Fl. Oz. amika: amika: curl corps enhancing gel 6.7 Fl. Oz. False amika/amikacurlcorpsenhancinggel6oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required amika: curl corps enhancing gel is a weather-proofing, curl-boosting gel that gives bouncy shape without the crunch factor. True Log in to view pricing! False

amika:
curl corps enhancing gel

6.7 Fl. Oz.

SKU 298044

Log in to view pricing!

Quick View

154595 499010 499010 1 Blow Dry Volumizing Gel 8.5 Fl. Oz. Sexy Hair Blow Dry Volumizing Gel 8.5 Fl. Oz. False sexyhair/sexyhairbigblowdryvolumizing8.5oz.jpg Bonus Deal Available 10.98 10.98 10.98 False False False False 0.00 False False Diversion contract is required Sexy Hair Big Sexy Blow Dry Volumizing Gel creates volume and lift with a workable, medium hold and style memory that lasts up to 48 hours. True Log in to view pricing! False

Blow Dry Volumizing Gel

8.5 Fl. Oz.

SKU 499010

Log in to view pricing!

Quick View

566 988335 988335 1 Hydro Gel Strong 5.1 Fl. Oz. Framesi BY framesi™ Hydro Gel Strong 5.1 Fl. Oz. False framesi/738884262329.jpg Bonus Deal Available 8.85 8.85 8.85 False False False False 0.00 False False Diversion contract is required A strong hold gel that fortifies hair, leaving no residue. Volumizes and enhances shine, lets your color shine through. True Log in to view pricing! False

BY framesi™ Hydro Gel Strong

5.1 Fl. Oz.

SKU 988335

Log in to view pricing!

Quick View

2638 528014 528014 1 Styling Gel 16 Fl. Oz. Clubman Clubman Styling Gel 16 Fl. Oz. False clubman/cl_jar_279200_stygel_hr.jpg Bonus Deal Available 8.00 8.00 8.00 False False False False 0.00 False False Diversion contract is required Specially formulated for me. True Log in to view pricing! False

Clubman
Styling Gel

16 Fl. Oz.

SKU 528014

Log in to view pricing!

Quick View

132746 252922 252922 1 This is a Curl Gel Oil 8.45 Fl. Oz. Davines Davines More Inside This is a Curl Gel Oil 8.45 Fl. Oz. False davines/davinesmoreinsidecurlgeloil8oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This is a Curl Gel Oil is formulated for extra-curly hair patterns and textures in mind. True Log in to view pricing! False

Davines
More Inside This is a Curl Gel Oil

8.45 Fl. Oz.

SKU 252922

Log in to view pricing!

Quick View

22981 251396 251396 1 This is a Medium Hold Modeling Gel 8.45 Fl. Oz. Davines Davines More Inside This is a Medium Hold Modeling Gel 8.45 Fl. Oz. False davines/davinesmoreinsidemodelinggel845floz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This Is A Medium Hold Modeling Gel gives body an elasticity to curls, dries quickly, and eliminates frizz. True Log in to view pricing! False

Davines
More Inside This is a Medium Hold Modeling Gel

8.45 Fl. Oz.

SKU 251396

Log in to view pricing!

Quick View

20829 251395 251395 1 This is a Strong Hold Cream Gel 4.22 Fl. Oz. Davines Davines More Inside This is a Strong Hold Cream Gel 4.22 Fl. Oz. False davines/davinesmoreinsidestrongcreamgel422floz.png Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This Is A Strong Hold Cream Gel is quick-drying, residue-free and workable. True Log in to view pricing! False

Davines
More Inside This is a Strong Hold Cream Gel

4.22 Fl. Oz.

SKU 251395

Log in to view pricing!

Quick View

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler