styling gel

19809 251242 251242 1 Gel 5.07 Fl. Oz. Davines Davines NaturalTech Purifying Gel 5.07 Fl. Oz. False davines/purifyinggel.jpg Bonus Deal Available 20.00 20.00 18.00 True False False False 18.00 False True Diversion contract is required Davines NaturalTech Purifying Gel is an antifungal and antibacterial gel that keeps the scalp clean and healthy. True Log in to view pricing! False

Davines
NaturalTech Purifying Gel

5.07 Fl. Oz.

SKU 251242

On SaleLog in to view pricing!

Quick View

161307 182619 182619 1 Curls Like Us Define & Seal Curl Defining Gelée 8.5 Fl. Oz. Joico Joico Curl Care Curls Like Us Define & Seal Curl Defining Gelée 8.5 Fl. Oz. False joico/joicocurlslikeusdefineandsealgelee.jpg Bonus Deal Available 14.45 14.45 10.00 True False False False 10.00 False False Diversion contract is required Keep your curls in formation with Joico Curls Like Us Define & Seal Curl Defining Gelée, the medium-hold gelée that won’t flake on you. True Log in to view pricing! False

Joico
Curl Care Curls Like Us Define & Seal Curl Defining Gelée

8.5 Fl. Oz.

SKU 182619

On SaleLog in to view pricing!

Quick View

109085 183275 183275 1 JoiGel Firm 8.5 Fl. Oz. Joico Joico JoiGel Firm 8.5 Fl. Oz. False joico/joicojoigelfirmstylinggel8.5.jpg Bonus Deal Available 12.22 12.22 10.00 True False False False 10.00 False False Diversion contract is required Joico JoiGel Firm is a firm-hold formula –which locks in shine and hydration and locks OUT pollution and humidity –coaxes those spirited strands into shape. True Log in to view pricing! False

Joico
JoiGel Firm

8.5 Fl. Oz.

SKU 183275

On SaleLog in to view pricing!

Quick View

168248 275626 275626 1 Curl Care Control Gel 4 4.2 Fl. Oz. Milbon Milbon Signature CURL Curl Care Control Gel 4 4.2 Fl. Oz. False milbon/milboncurlcontrolgel.jpg Bonus Deal Available 15.00 15.00 12.75 True False False False 12.75 False True Diversion contract is required Milbon CURL Curl Care Control Gel 4 defines and hydrates, enhancing natural curls and softness. True Log in to view pricing! False

Milbon
Signature CURL Curl Care Control Gel 4

4.2 Fl. Oz.

SKU 275626

On SaleLog in to view pricing!

Quick View

154582 499007 499007 1 Hard Up Hard Holding Gel 5.1 Fl. Oz. Sexy Hair Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz. True sexyhair/sexyhairstylehardupgel5.1oz.jpg Bonus Deal Available 10.98 10.98 8.00 True False False False 8.00 False False Diversion contract is required Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a high hold finish and humidity resistance that lasts up to 72 hours. True Log in to view pricing! False

Sexy Hair
Hard Up Hard Holding Gel

On SaleLog in to view pricing!

View Sizes

178857 380028 380028 1 CREME GEL ELIXIR 6 Fl. Oz. shibui shibui EVERYDAYNESS CREME GEL ELIXIR 6 Fl. Oz. False shibui/shibuicremegelelixir.jpg Bonus Deal Available 12.00 12.00 10.80 True False False False 10.80 False False Diversion contract is required shibui CREME GEL ELIXIR and builds structure with texture and control while infusing hair with nutrition and thermal protection. True Log in to view pricing! False

shibui
EVERYDAYNESS CREME GEL ELIXIR

6 Fl. Oz.

SKU 380028

On SaleLog in to view pricing!

Quick View

156125 559221 559221 1 curl foaming gel 6.7 Fl. Oz. Verb Verb curl foaming gel 6.7 Fl. Oz. False verb/verbcurlfoaminggel6.7.jpg Bonus Deal Available 12.22 12.22 9.78 True False False False 9.78 False False Diversion contract is required Verb curl foaming gel adds frizz control, lightweight hold, and definition without stiffness. True Log in to view pricing! False

Verb
curl foaming gel

6.7 Fl. Oz.

SKU 559221

On SaleLog in to view pricing!

Quick View

175008 595710 595710 1 Frozen Gel 5.25 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Style&Care Frozen Gel 5.25 Fl. Oz. False alfaparfmilano/alfaparf25styleandcaresdlfrozengel525oz.jpg Bonus Deal Available 15.75 15.75 15.75 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Style&Care Frozen Gel is an extra-strong hold gel perfect for creating long-lasting ice effect looks. True Log in to view pricing! False

Alfaparf Milano
Semi Di Lino Style&Care Frozen Gel

5.25 Fl. Oz.

SKU 595710

Log in to view pricing!

Quick View

51968 298044 298044 1 curl corps enhancing gel 6.7 Fl. Oz. amika: amika: curl corps enhancing gel 6.7 Fl. Oz. False amika/amikacurlcorpsenhancinggel6oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required amika: curl corps enhancing gel is a weather-proofing, curl-boosting gel that gives bouncy shape without the crunch factor. True Log in to view pricing! False

amika:
curl corps enhancing gel

6.7 Fl. Oz.

SKU 298044

Log in to view pricing!

Quick View

2638 528014 528014 1 Styling Gel 16 Fl. Oz. Clubman Clubman Styling Gel 16 Fl. Oz. False clubman/cl_jar_279200_stygel_hr.jpg Bonus Deal Available 8.00 8.00 8.00 False False False False 0.00 False False Diversion contract is required Specially formulated for me. True Log in to view pricing! False

Clubman
Styling Gel

16 Fl. Oz.

SKU 528014

Log in to view pricing!

Quick View

175338 496004 496004 1 Gel++ 12 Fl. Oz. CURL CLINIC+ CURL CLINIC+ Gel++ 12 Fl. Oz. True curlclinic/curlclinicplusgel12oz.jpg Bonus Deal Available 22.00 22.00 22.00 False False False False 0.00 False False Diversion contract is required CURL CLINIC+ Gel++ delivers long-lasting hold and definition while locking in moisture and protecting curls from frizz. True Log in to view pricing! False

CURL CLINIC+
Gel++

Log in to view pricing!

View Sizes

132746 252922 252922 1 This is a Curl Gel Oil 8.45 Fl. Oz. Davines Davines More Inside This is a Curl Gel Oil 8.45 Fl. Oz. False davines/davinesmoreinsidecurlgeloil8oz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This is a Curl Gel Oil is formulated for extra-curly hair patterns and textures in mind. True Log in to view pricing! False

Davines
More Inside This is a Curl Gel Oil

8.45 Fl. Oz.

SKU 252922

Log in to view pricing!

Quick View

22981 251396 251396 1 This is a Medium Hold Modeling Gel 8.45 Fl. Oz. Davines Davines More Inside This is a Medium Hold Modeling Gel 8.45 Fl. Oz. False davines/davinesmoreinsidemodelinggel845floz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This Is A Medium Hold Modeling Gel gives body an elasticity to curls, dries quickly, and eliminates frizz. True Log in to view pricing! False

Davines
More Inside This is a Medium Hold Modeling Gel

8.45 Fl. Oz.

SKU 251396

Log in to view pricing!

Quick View

20829 251395 251395 1 This is a Strong Hold Cream Gel 4.22 Fl. Oz. Davines Davines More Inside This is a Strong Hold Cream Gel 4.22 Fl. Oz. False davines/davines_moreinside_strong-cream-gel_4.22oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False True Diversion contract is required Davines More Inside This Is A Strong Hold Cream Gel is quick-drying, residue-free and workable. True Log in to view pricing! False

Davines
More Inside This is a Strong Hold Cream Gel

4.22 Fl. Oz.

SKU 251395

Log in to view pricing!

Quick View

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 15.55 15.55 15.55 False False False False 0.00 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Log in to view pricing!

View Sizes

Davines
NaturalTech Purifying Gel

Joico
Curl Care Curls Like Us Define & Seal Curl Defining Gelée

Joico
JoiGel Firm

Milbon
Signature CURL Curl Care Control Gel 4

Sexy Hair
Hard Up Hard Holding Gel

shibui
EVERYDAYNESS CREME GEL ELIXIR

Verb
curl foaming gel

Alfaparf Milano
Semi Di Lino Style&Care Frozen Gel

amika:
curl corps enhancing gel

Clubman
Styling Gel

CURL CLINIC+
Gel++

Davines
More Inside This is a Curl Gel Oil

Davines
More Inside This is a Medium Hold Modeling Gel

Davines
More Inside This is a Strong Hold Cream Gel

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

As Seen on Instagram

Volume Pricing

Product Pack

styling gel

DavinesNaturalTech Purifying Gel

JoicoCurl Care Curls Like Us Define & Seal Curl Defining Gelée

JoicoJoiGel Firm

MilbonSignature CURL Curl Care Control Gel 4

Sexy HairHard Up Hard Holding Gel

shibuiEVERYDAYNESS CREME GEL ELIXIR

Verbcurl foaming gel

Alfaparf MilanoSemi Di Lino Style&Care Frozen Gel

amika:curl corps enhancing gel

ClubmanStyling Gel

CURL CLINIC+Gel++

DavinesMore Inside This is a Curl Gel Oil

DavinesMore Inside This is a Medium Hold Modeling Gel

DavinesMore Inside This is a Strong Hold Cream Gel

DevaCurlLIGHT DEFINING GEL Soft Hold No-Crunch Styler

As Seen on Instagram

Processing Your Request

Davines
NaturalTech Purifying Gel

Joico
Curl Care Curls Like Us Define & Seal Curl Defining Gelée

Joico
JoiGel Firm

Milbon
Signature CURL Curl Care Control Gel 4

Sexy Hair
Hard Up Hard Holding Gel

shibui
EVERYDAYNESS CREME GEL ELIXIR

Verb
curl foaming gel

Alfaparf Milano
Semi Di Lino Style&Care Frozen Gel

amika:
curl corps enhancing gel

Clubman
Styling Gel

CURL CLINIC+
Gel++

Davines
More Inside This is a Curl Gel Oil

Davines
More Inside This is a Medium Hold Modeling Gel

Davines
More Inside This is a Strong Hold Cream Gel

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler