styling gel

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 13.35 True False False False 13.35 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 13.35 True False False False 13.35 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

On SaleLog in to view pricing!

View Sizes

154582 499007 499007 1 Hard Up Hard Holding Gel 5.1 Fl. Oz. Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz. True sexyhair/sexyhairstylehardupgel5.1oz.jpg Bonus Deal Available 10.98 10.98 8.50 True False False False 8.50 False False Diversion contract is required Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a maximum high hold finish and humidity resistance that lasts up to 48 hours. True Log in to view pricing! False

Hard Up Hard Holding Gel

On SaleLog in to view pricing!

View Sizes

154595 499010 499010 1 Blow Dry Volumizing Gel 8.5 Fl. Oz. Sexy Hair Blow Dry Volumizing Gel 8.5 Fl. Oz. False sexyhair/sexyhairbigblowdryvolumizing8.5oz.jpg Bonus Deal Available 10.98 10.98 10.98 False False False False 0.00 False False Diversion contract is required Sexy Hair Big Sexy Blow Dry Volumizing Gel creates volume and lift with a workable, medium hold and style memory that lasts up to 48 hours. True Log in to view pricing! False

Blow Dry Volumizing Gel

8.5 Fl. Oz.

SKU 499010

Log in to view pricing!

Quick View

566 988335 988335 1 Hydro Gel Strong 5.1 Fl. Oz. Framesi BY framesi™ Hydro Gel Strong 5.1 Fl. Oz. False framesi/738884262329.jpg Bonus Deal Available 8.85 8.85 8.85 False False False False 0.00 False False Diversion contract is required A strong hold gel that fortifies hair, leaving no residue. Volumizes and enhances shine, lets your color shine through. True Log in to view pricing! False

BY framesi™ Hydro Gel Strong

5.1 Fl. Oz.

SKU 988335

Log in to view pricing!

Quick View

166030 889091 889091 1 Firm Hold Gel 4.2 Fl. Oz. eufora eufora FOR HIM Firm Hold Gel 4.2 Fl. Oz. False eufora/euforaforhimfirmholdgel4oz.jpg Bonus Deal Available 10.50 10.50 10.50 False False False False 0.00 False False Diversion contract is required eufora FOR HIM Firm Hold Gel is a strong hold styling gel for delivering maximum hold and shine. True Log in to view pricing! False

eufora
FOR HIM Firm Hold Gel

4.2 Fl. Oz.

SKU 889091

Log in to view pricing!

Quick View

165955 622001 622001 1 MODE Styling Gel 6.7 Fl. Oz. JOHNNY B. JOHNNY B. MODE Styling Gel 6.7 Fl. Oz. True johnnyb/jbmodestylinggel6oz.jpg Bonus Deal Available 6.50 6.50 6.50 False False False False 0.00 False False Diversion contract is required JOHNNY B. MODE Styling Gel is a high-shine gel that is great for creating wet looks or styles that require a strong hold. True Log in to view pricing! False

JOHNNY B.
MODE Styling Gel

Log in to view pricing!

View Sizes

109085 183275 183275 1 JoiGel Firm 8.5 Fl. Oz. Joico Joico JoiGel Firm 8.5 Fl. Oz. False joico/joicojoigelfirm.jpg Bonus Deal Available 11.95 11.95 11.95 False False False False 0.00 False False Diversion contract is required Joico JoiGel Firm is a firm-hold formula –which locks in shine and hydration and locks OUT pollution and humidity –coaxes those spirited strands into shape. True Log in to view pricing! False

Joico
JoiGel Firm

8.5 Fl. Oz.

SKU 183275

Log in to view pricing!

Quick View

137669 420155 420155 1 AllCurl Defining Jelly 3 Fl. Oz. Kenra Professional Kenra Professional AllCurl Defining Jelly 3 Fl. Oz. False kenraprofessional/kenraprofessionalallcurldefiningjelly3oz.jpg Bonus Deal Available 10.53 10.53 10.53 False False False False 0.00 False False Diversion contract is required Kenra Professional AllCurl Defining Jelly is a light hold no-crunch gel that enhances curls with frizz control, enhances shine, and manageability. True Log in to view pricing! False

Kenra Professional
AllCurl Defining Jelly

3 Fl. Oz.

SKU 420155

Log in to view pricing!

Quick View

121131 420055 420055 1 Styling Gel 17 6 Fl. Oz. Kenra Professional Kenra Professional Styling Gel 17 6 Fl. Oz. False kenraprofessional/2419764KenraProfessionalStylingGel6floz.jpg Bonus Deal Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required Kenra Professional Styling Gel 17 designed to create versatile looks. True Log in to view pricing! False

Kenra Professional
Styling Gel 17

6 Fl. Oz.

SKU 420055

Log in to view pricing!

Quick View

58778 485858 485858 1 Classic Gel 5.1 Fl. Oz. Keune Keune 1922 by J.M. Keune Classic Gel 5.1 Fl. Oz. False keune/keune1922gel.png Bonus Deal Available 13.25 13.25 13.25 False False False False 0.00 False False Diversion contract is required Keune 1922 by J.M. Keune Classic Styling Gel with extra strong hold and shine. Locks any style in place. Contains Creatine and Hemp. True Log in to view pricing! False

Keune
1922 by J.M. Keune Classic Gel

5.1 Fl. Oz.

SKU 485858

Log in to view pricing!

Quick View

162730 486069 486069 1 HEAD LOCK 6.8 Fl. Oz. Keune Keune Style HEAD LOCK 6.8 Fl. Oz. False keune/keuneheadlock6.8oz.jpg Bonus Deal Available 13.25 13.25 13.25 False False False False 0.00 False False Diversion contract is required Keune's HEAD LOCK is a timeless classic in the range. First conceptualized and meticulously crafted in 1977, this gel has stood the test of time and is all about structure, shine — and amazing hold. True Log in to view pricing! False

Keune
Style HEAD LOCK

6.8 Fl. Oz.

SKU 486069

Log in to view pricing!

Quick View

70901 119045 119045 1 Maximum Volumizing Solution 8 Fl. Oz. LOMA LOMA Maximum Volumizing Solution 8 Fl. Oz. True loma/lomamaxvolumesol8oz.jpg Bonus Deal Available 11.00 11.00 11.00 False False False False 0.00 False False Diversion contract is required LOMA Maximum Volumizing Solution is a volume building styling solution for medium to firm hold. True Log in to view pricing! False

LOMA
Maximum Volumizing Solution

Log in to view pricing!

View Sizes

40037 275185 275185 1 Wet Shine Gel Cream 5 5.3 Fl. Oz. Milbon Milbon Signature CREATIVE STYLE Wet Shine Gel Cream 5 5.3 Fl. Oz. False milbon/milboncreativestylewetshinegelcream553oz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False True Diversion contract is required Milbon Signature CREATIVE STYLE Wet Shine Gel Cream 5 gives a wet-looking, shiny finish with control and movement. True Log in to view pricing! False

Milbon
Signature CREATIVE STYLE Wet Shine Gel Cream 5

5.3 Fl. Oz.

SKU 275185

Log in to view pricing!

Quick View

40038 275186 275186 1 Wet Shine Gel Cream 8 5.3 Fl. Oz. Milbon Milbon Signature CREATIVE STYLE Wet Shine Gel Cream 8 5.3 Fl. Oz. False milbon/milboncreativestylewetshinegelcream853oz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False True Diversion contract is required Milbon Signature CREATIVE STYLE Wet Shine Gel Cream 8 gives a wet-looking, shiny finish with control and movement. True Log in to view pricing! False

Milbon
Signature CREATIVE STYLE Wet Shine Gel Cream 8

5.3 Fl. Oz.

SKU 275186

Log in to view pricing!

Quick View

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler