6 brands, one stage – runway is back! Get tickets to the color event of the year

hair care shampoo

(65 Items)
  • 109473 491443 491443 1 CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. True devacurl/devagscurlbondcleanser12oz.jpg Bonus Deal Available 18.90 18.90 14.18 True False False False 14.18 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Mild Lather Cleanser

    Bonus Offer
    View Sizes
  • 109484 491464 491464 1 NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoodecadence12oz.jpg Bonus Deal Available 17.80 17.80 13.35 True False False False 13.35 False False Diversion contract is required DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture is designed for dry coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz.

    DevaCurl
    NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture

    Bonus Offer
    View Sizes
  • 137260 486039 486039 1 Shampoo 10.1 Fl. Oz. Keune Keune Care Blonde Savior Shampoo 10.1 Fl. Oz. True keune/keunecareblondesaviorshampoo10oz.jpg Bonus Deal Available 14.80 14.80 10.36 True False False False 10.36 False False Diversion contract is required Keune Care Blonde Savior Shampoo is a sulfate-free shampoo formulated with Glycolic Acid and Creatine to support sensitized, compromised, and decolorized hair. True Log in to view pricing! False
    Keune Shampoo 10.1 Fl. Oz.

    Keune
    Care Blonde Savior Shampoo

    Bonus Offer
    View Sizes
  • 44279 485702 485702 1 Shampoo 10.1 Fl. Oz. Keune Keune Care Keratin Smooth Shampoo 10.1 Fl. Oz. True keune/carekeratinsmoothshampoo300ml.jpg Bonus Deal Available 13.25 13.25 9.28 True False False False 9.28 False False Diversion contract is required Keune Care Keratin Smooth Shampoo is infused with keratin and Provitamin B5, that nourishes, moisturizes and adds shine to your hair. It leaves damaged, dry, or normal hair silky smooth, healthy and protected against further breakage. True Log in to view pricing! False
    Keune Shampoo 10.1 Fl. Oz.

    Keune
    Care Keratin Smooth Shampoo

    Bonus Offer
    View Sizes
  • 37955 485572 485572 1 Tinta Color Shampoo 10.1 Fl. Oz. Keune Keune Care Tinta Color Shampoo 10.1 Fl. Oz. True keune/keune_tinta_colorshampoo_10oz.jpg Bonus Deal Available 14.80 14.80 10.36 True False False False 10.36 False False Diversion contract is required Keune Tinta Color Shampoo repairs and nourishes damaged hair and shields from UV damage and color fading for long-lasting hair color. True Log in to view pricing! False
    Keune Tinta Color Shampoo 10.1 Fl. Oz.

    Keune
    Care Tinta Color Shampoo

    Bonus Offer
    View Sizes
  • 44219 485669 485669 1 Shampoo 10.1 Fl. Oz. Keune Keune Care Vital Nutrition Shampoo 10.1 Fl. Oz. True keune/keune_vitalshampoo_10oz.jpg Bonus Deal Available 13.25 13.25 9.28 True False False False 9.28 False False Diversion contract is required Keune Care Vital Nutrition Shampoo is for hair in need of TLC. It restores your hair's moisture balance while intensely nourishing each individual strand. True Log in to view pricing! False
    Keune Shampoo 10.1 Fl. Oz.

    Keune
    Care Vital Nutrition Shampoo

    Bonus Offer
    View Sizes
  • 49034 624129 624129 1 Shampoo 10.1 Fl. Oz. L'ANZA L'ANZA KERATIN HEALING OIL Shampoo 10.1 Fl. Oz. True lanza/keratinshampoo300.jpg Bonus Deal Available 22.25 22.25 16.69 True False False False 16.69 False False Diversion contract is required Keratin Healing Oil Shampoo replenishes vital Keratin Protein to restore hair’s volume, strength and health. True Log in to view pricing! False
    L'ANZA Shampoo 10.1 Fl. Oz.

    L'ANZA
    KERATIN HEALING OIL Shampoo

    Bonus Offer
    View Sizes
  • 70963 119017 119017 1 Nourishing Shampoo 12 Fl. Oz. LOMA LOMA Nourishing Shampoo 12 Fl. Oz. True loma/lomanourishingshampoo8oz.jpg Bonus Deal Available 11.50 11.50 11.50 False False False False 0.00 False False Diversion contract is required LOMA Nourishing Shampoo contains certified organic ingredients specifically selected to enhance, protect, restore and repair the hair's natural moisture balance while providing vibrant shine. True Log in to view pricing! False
    LOMA Nourishing Shampoo 12 Fl. Oz.

    LOMA
    Nourishing Shampoo

    Bonus Offer
    View Sizes
  • 51098 773420 773420 1 a-Keratin Hydrating & Repairing Shampoo 10 Fl. Oz. Peter Coppola Peter Coppola a-Keratin Hydrating & Repairing Shampoo 10 Fl. Oz. True petercoppolabeauty/hydrate_repair_shamp.jpg Bonus Deal Available 16.55 16.55 16.55 False False False False 0.00 False False Diversion contract is required a-Keratin Hydrating & Repairing shampoo has been formulated to treat hair damaged from technical services, including bleaching, chemical straightening, perms, and excessive styling. True Log in to view pricing! False
    Peter Coppola a-Keratin Hydrating & Repairing Shampoo 10 Fl. Oz.

    Peter Coppola
    a-Keratin Hydrating & Repairing Shampoo

    Bonus Offer
    View Sizes
  • 168112 756294 756294 1 Shampoo 10 Fl. Oz. PRAVANA PRAVANA Volume Vibrance Shampoo 10 Fl. Oz. False pravana/pravanavolumevibranceshampoo10ozx.jpg Bonus Deal Available 10.99 10.99 8.79 True False False False 8.79 False False Diversion contract is required PRAVANA Volume Vibrance Shampoo is ideal for thin, color-treated hair that needs enhanced shine and color protection. True Log in to view pricing! False
    PRAVANA Shampoo 10 Fl. Oz.

    PRAVANA
    Volume Vibrance Shampoo

    10 Fl. Oz.

    SKU 756294

    Bonus Offer
    Quick View
  • 137690 595265 595265 1 Deep Cleansing Shampoo 16.9 Fl. Oz. Alfaparf Milano Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo 16.9 Fl. Oz. False alfaparfmilano/alfaparfmilanoktlddeepcleansingshampoo16oz.jpg Bonus Deal Available 22.50 22.50 22.50 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo washes thoroughly and untangles hair perfectly. True Log in to view pricing! False
    Alfaparf Milano Deep Cleansing Shampoo 16.9 Fl. Oz.

    Alfaparf Milano
    Lisse Design Keratin Therapy Deep Cleansing Shampoo

    16.9 Fl. Oz.

    SKU 595265

    Bonus Offer
    Quick View
  • 65391 595278 595278 1 Reparative Low Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/am_sdl-reconstruction-reparative-low-shampoo-8-45_oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo is a gentle restructuring shampoo for damaged hair. True Log in to view pricing! False
    Alfaparf Milano Reparative Low Shampoo 8.45 Fl. Oz.

    Alfaparf Milano
    Semi Di Lino Reconstruction Reparative Low Shampoo

    Bonus Offer
    View Sizes
  • 89166 595318 595318 1 Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. False alfaparfmilano/alfaparfsdlscalprenewenergyshampoo8.45oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo gently strengthens, re-densifies and stimulates the hair follicles so that both the scalp and hair fibers can regain balance, strength and body. True Log in to view pricing! False
    Alfaparf Milano Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz.

    Alfaparf Milano
    Semi Di Lino Scalp Renew Energizing Low Shampoo

    8.45 Fl. Oz.

    SKU 595318

    Bonus Offer
    Quick View
  • 27504 641525 641525 1 Reparative Shampoo 10.1 Fl. Oz. Aloxxi Aloxxi Reparative Shampoo 10.1 Fl. Oz. True aloxxi/repair-shampoo-retail.jpg Bonus Deal Available 13.90 13.90 13.90 False False False False 0.00 False False Diversion contract is required Aloxxi's Reparative Shampoo renews damaged hair and restores hydration without stripping strands of nourishment. True Log in to view pricing! False
    Aloxxi Reparative Shampoo 10.1 Fl. Oz.

    Aloxxi
    Reparative Shampoo

    Bonus Offer
    View Sizes
  • 33703 795001 795001 1 Shampoo 8.5 Fl. Oz. ALTERNA Professional ALTERNA Professional Caviar Anti-Aging Replenishing MOISTURE Shampoo 8.5 Fl. Oz. True alternaprofessional/alternaprofessionalreplenishingmoistureshampoo8oz.jpg Bonus Deal Available 18.00 18.00 18.00 False False False False 0.00 False False Diversion contract is required ALTERNA Professional Caviar Anti-Aging Replenishing MOISTURE Shampoo helps to restore and rebalance moisture to hair for noticeably softer, smoother, shinier hair that feels transformed after one use. True Log in to view pricing! False
    ALTERNA Professional Shampoo 8.5 Fl. Oz.

    ALTERNA Professional
    Caviar Anti-Aging Replenishing MOISTURE Shampoo

    Bonus Offer
    View Sizes
(65 Items)