styling

Save 10% Off Sitewide Today Only!

Never miss a sale! Sign up for our texts

(21 Items)

165625 491402P 491402P 1 Large Intro 46 pc. DevaCurl DevaCurl Large Intro 46 pc. False devacurl/devacurllargeintro46pc.jpg Bonus Deal Available 999.00 999.00 999.00 False True False False 0.00 False False Diversion contract is required 0 DevaCurl Large Intro includes shampoo, conditioner, mask, serum, treatment, leave-in, a variety of styling products, towel, dryer, dryer attachment, and education. True Log in to view pricing! False

DevaCurl
Large Intro

46 pc.

SKU 491402P

Promotional ItemLog in to view pricing!
Quick View
165626 491401P 491401P 1 Small Intro 27 pc. DevaCurl DevaCurl Small Intro 27 pc. False devacurl/devacurlsmallintro27pc.jpg Bonus Deal Available 475.00 475.00 475.00 False True False False 0.00 False False Diversion contract is required 0 DevaCurl Small Intro includes shampoo, conditioner, mask, serum, treatment, a variety of styling products, towel, dryer attachment, and education. True Log in to view pricing! False

DevaCurl
Small Intro

27 pc.

SKU 491401P

Promotional ItemLog in to view pricing!
Quick View
165627 491400P 491400P 1 Starter Kit 8 pc. DevaCurl DevaCurl Starter Kit 8 pc. False devacurl/devacurlstarterkit8pc.jpg Bonus Deal Available 99.00 99.00 99.00 False True False False 0.00 False False Diversion contract is required 0 DevaCurl Starter Kit includes shampoo, conditioner, gel, cream, leave-in, foam, and education. True Log in to view pricing! False

DevaCurl
Starter Kit

8 pc.

SKU 491400P

Promotional ItemLog in to view pricing!
Quick View
109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

On SaleLog in to view pricing!
View Sizes
109742 491415 491415 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

DevaCurl
PLUMPING PRIMER Body-Building Gelée

On SaleLog in to view pricing!
View Sizes
109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

On SaleLog in to view pricing!
View Sizes
135792 491483 491483 1 DEVAFAST DRY Accelerator Spray 6 Fl. Oz. DevaCurl DevaCurl DEVAFAST DRY Accelerator Spray 6 Fl. Oz. False devacurl/devacurldevafastdrydryacceleratorspray6oz.jpg Bonus Deal Available 16.65 16.65 16.65 False False False False 0.00 False False Diversion contract is required 0 Speed up your air-dry & diffusing time up to 66% with Devacurl's DEVAFAST DRY Accelerator Spray! This lightweight dry accelerating spray helps accelerate the rate at which water evaporates from the hair's surface. True Log in to view pricing! False

DevaCurl
DEVAFAST DRY Accelerator Spray

6 Fl. Oz.

SKU 491483

Log in to view pricing!
Quick View
109682 491414 491414 1 DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. DevaCurl DevaCurl DEVAFRESH Scalp & Hair Revitalizer 3 Fl. Oz. False devacurl/devacurldevafresh.jpg Bonus Deal Available 12.25 12.25 12.25 False False False False 0.00 False False Diversion contract is required 0 DevaCurl DEVAFRESH Scalp & Hair Revitalizer is a style-extending spray with the Time Released Freshness Complex that maintains moisture, reduces frizz, and provides 48 hour odor control and a cooling scalp sensation. True Log in to view pricing! False

DevaCurl
DEVAFRESH Scalp & Hair Revitalizer

3 Fl. Oz.

SKU 491414

Log in to view pricing!
Quick View
109679 491432 491432 1 FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. DevaCurl DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler 10 Fl. Oz. False devacurl/devacurlflexibleholdhairspray.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler is a flexible hold hairspray. True Log in to view pricing! False

DevaCurl
FLEXIBLE HOLD HAIRSPRAY No-Crunch Finishing Styler

10 Fl. Oz.

SKU 491432

Log in to view pricing!
Quick View
122879 491476 491476 1 Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicsupercream51floz.jpg Bonus Deal Available 18.90 18.90 18.90 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM's hydra-definition blend provides coarse curls with smoothness, shape, shine and frizz control. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic SUPERCREAM

5.1 Fl. Oz.

SKU 491476

Log in to view pricing!
Quick View
122877 491475 491475 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

12 Fl. Oz.

SKU 491475

Log in to view pricing!
Quick View
142279 491490 491490 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 22.25 22.25 22.25 False False False False 0.00 False False Diversion contract is required 0 DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False

DevaCurl
MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray

Log in to view pricing!
View Sizes
109741 491431 491431 1 MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. DevaCurl DevaCurl MOISTURE SEAL Hydrating Finishing Spray 8 Fl. Oz. False devacurl/devacurlnewpackagingdevagsmoistureseal8oz.jpg Bonus Deal Available 16.65 16.65 16.65 False False False False 0.00 False False Diversion contract is required 0 DevaCurl MOISTURE SEAL Hydrating Finishing Spray previously SET IT FREE, is a lightweight formula with a moisture locking blend brings much-needed hydration to dry curls helping to fight frizz and provide softness and shine. True Log in to view pricing! False

DevaCurl
MOISTURE SEAL Hydrating Finishing Spray

8 Fl. Oz.

SKU 491431

Log in to view pricing!
Quick View
109666 491438 491438 1 SCALP D(pH)ENSE Daily Nourishing & Protecting Serum 1 Fl. Oz. DevaCurl DevaCurl SCALP D(pH)ENSE Daily Nourishing & Protecting Serum 1 Fl. Oz. False devacurl/devacurlnewpackagingdevagsscalpdphense1oz.jpg Bonus Deal Available 21.65 21.65 21.65 False False False False 0.00 False False Diversion contract is required 0 DevaCurl SCALP D(pH)ENSE Daily Nourishing & Protecting Serum is a non-oily, nourishing serum with Scalp Re-Balancing Complex to moisturize dry scalp. True Log in to view pricing! False

DevaCurl
SCALP D(pH)ENSE Daily Nourishing & Protecting Serum

1 Fl. Oz.

SKU 491438

Log in to view pricing!
Quick View
109669 491437 491437 1 SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray 8 Fl. Oz. DevaCurl DevaCurl SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray 8 Fl. Oz. False devacurl/devascalppuriphydailynourishing8oz.jpg Bonus Deal Available 22.75 22.75 22.75 False False False False 0.00 False False Diversion contract is required 0 DevaCurl SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray gently removes scalp buildup. True Log in to view pricing! False

DevaCurl
SCALP PURI(pH)Y Easy-Rinse Exfoliating Spray

8 Fl. Oz.

SKU 491437

Log in to view pricing!
Quick View