On Sale

164625 298277 298277 1 the wizard detangling primer 2 Fl. Oz. amika: amika: the wizard detangling primer 2 Fl. Oz. False amika/amikathewizarddetanglingprimer2oz.jpg Bonus Deal Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required Meet the first step in every haircare routine. amika: the wizard detangling primer is a weightless, multi-benefit priming spray that detangles, cuts blow dry time and protects against thermal damage. Leaves hair smooth, soft and radiant. True Log in to view pricing! False

158331 298258 298258 1 the wizard detangling primer 5 Fl. Oz. amika: amika: the wizard detangling primer 5 Fl. Oz. False amika/amikathewizard5oz.jpg Bonus Deal Available 16.50 16.50 13.20 True False False False 13.20 False False Diversion contract is required Meet the first step in every haircare routine. amika: the wizard detangling primer is a weightless, multi-benefit priming spray that detangles, cuts blow dry time and protects against thermal damage. Leaves hair smooth, soft and radiant. True Log in to view pricing! False

137637 298186 298186 1 the wizard silicone-free detangling primer 5.1 Fl. Oz. amika: amika: the wizard silicone-free detangling primer 5.1 Fl. Oz. False amika/amikathewizardsiliconefreedetanglingprimer5oz.jpg Bonus Deal Available 16.50 16.50 13.20 True False False False 13.20 False False Diversion contract is required amika: the wizard silicone-free detangling primer is a silicone-free all-in-one hair detangling mist that preps + primes your hair for any style. True Log in to view pricing! False

566 988335 988335 1 Hydro Gel Strong 5.1 Fl. Oz. Framesi BY framesi™ Hydro Gel Strong 5.1 Fl. Oz. False framesi/738884262329.jpg Bonus Deal Available 8.85 8.85 4.60 True False False False 4.60 False False Diversion contract is required A strong hold gel that fortifies hair, leaving no residue. Volumizes and enhances shine, lets your color shine through. True Log in to view pricing! False

563 988331 988331 1 Mist Hair Spray Light 10 Fl. Oz. Framesi BY framesi™ Mist Hair Spray Light 10 Fl. Oz. False framesi/738884262299.jpg Bonus Deal Available 13.85 13.85 7.20 True False False False 7.20 False False Diversion contract is required An ultra-fine, fast drying working hair spray with pearl protein. Will not build up and lets your color shine through. True Log in to view pricing! False

564 988332 988332 1 Mist Hair Spray Strong 10 Fl. Oz. Framesi BY framesi™ Mist Hair Spray Strong 10 Fl. Oz. False framesi/by-mhs_strong.jpg Bonus Deal Available 13.85 13.85 7.20 True False False False 7.20 False False Diversion contract is required A fast drying aerosol with an extra-firm hold. Will not build up or flake, lets your color shine through. True Log in to view pricing! False

568 988337 988337 1 Sparkling Mousse Strong 6.9 Fl. Oz. Framesi BY framesi™ Sparkling Mousse Strong 6.9 Fl. Oz. False framesi/738884262343.jpg Bonus Deal Available 12.70 12.70 6.63 True False False False 6.63 False False Diversion contract is required A moisture-rich foam formulated to protect and moisturize while creating ultimate hold, volume, and shine. Lets your color shine through. True Log in to view pricing! False

37132 988439 988439 1 Working Clay 2.7 Fl. Oz. Framesi BY framesi™ Working Clay 2.7 Fl. Oz. False framesi/bybottle.jpg Bonus Deal Available 11.05 11.05 5.75 True False False False 5.75 False False Diversion contract is required Framesi BY framesi Working Clay is a dry, yet workable strong hold sculpting wax that gives hair the flexibility to shape and reshape with a matte finish. True Log in to view pricing! False

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. False devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

109740 491421 491421 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter False devacurl/devacurlnewpackagingdevagslightdefininggel32oz.jpg Bonus Deal Available 32.20 32.20 25.76 True False False False 25.76 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. False devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

109768 491423 491423 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter False devacurl/devacurlnewpackagingdevagsultradefininggel32oz.jpg Bonus Deal Available 32.20 32.20 25.76 True False False False 25.76 False False Diversion contract is required DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

68584 988546 988546 1 Curl Pudding Defining Cream 6 Fl. Oz. Framesi FRAMESI COLOR LOVER™ Curl Pudding Defining Cream 6 Fl. Oz. False framesi/frclcurlpudding.jpg Bonus Deal Available 14.95 14.95 7.77 True False False False 7.77 False False Diversion contract is required Curl Pudding is made for the Curl lover! True Log in to view pricing! False

119657 988610 988610 1 Hair Straightening Serum 6 Fl. Oz. Framesi FRAMESI COLOR LOVER™ Hair Straightening Serum 6 Fl. Oz. False framesi/framesicolorloverhairstraighteningcream6oz.jpg Bonus Deal Available 14.95 14.95 7.77 True False False False 7.77 False False Diversion contract is required Framesi Color Lover Hair Straightening Serum is a strong topical straightening serum. True Log in to view pricing! False

158832 183629 183629 1 Blonde Strong Detangler 6.7 Fl. Oz. Joico Joico Blonde Life Blonde Strong Detangler 6.7 Fl. Oz. False joico/joicoblondelifeblondestrongdetangler.jpg Bonus Deal Available 16.11 16.11 10.88 True False False False 10.88 False False Diversion contract is required Joico Blonde Life Blonde Strong Detangler is a multitasking protector that helps detangle those fragile strands while keeping them resilient and shielded from UV rays and heat-styling tools. True Log in to view pricing! False