On Sale

33763 795064 795064 1 DENSIFYING Styling Mousse 5.1 Fl. Oz. ALTERNA Professional ALTERNA Professional Caviar Anti-Aging Clinical DENSIFYING Styling Mousse 5.1 Fl. Oz. False alternaprofessional/alternadensifyingmousse.jpg Bonus Deal Available 19.00 19.00 14.25 True False False False 14.25 False False Diversion contract is required 0 ALTERNA Professional Caviar Anti-Aging Clinical DENSIFYING Styling Mousse is a lightweight, densifying mousse that thickens and strengthens hair while helping to prevent breakage. True Log in to view pricing! False

109733 491420 491420 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. False devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

109740 491421 491421 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter False devacurl/devacurlnewpackagingdevagslightdefininggel32oz.jpg Bonus Deal Available 32.20 32.20 25.76 True False False False 25.76 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

109744 491416 491416 1 PLUMPING PRIMER Body-Building Gelée 16 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 16 Fl. Oz. False devacurl/devacurlnewpackagingdevagsplumpingprimer16oz.jpg Bonus Deal Available 27.80 27.80 22.24 True False False False 22.24 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

109742 491415 491415 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. False devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 13.85 13.85 13.85 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

109765 491422 491422 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. False devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 17.80 17.80 17.80 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

109768 491423 491423 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter False devacurl/devacurlnewpackagingdevagsultradefininggel32oz.jpg Bonus Deal Available 32.20 32.20 25.76 True False False False 25.76 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

68584 988546 988546 1 Curl Pudding Defining Cream 6 Fl. Oz. Framesi FRAMESI COLOR LOVER™ Curl Pudding Defining Cream 6 Fl. Oz. False framesi/frclcurlpudding.jpg Bonus Deal Available 13.95 13.95 9.77 True False False False 9.77 False False Diversion contract is required 0 Curl Pudding is made for the Curl lover! True Log in to view pricing! False

119657 988610 988610 1 Hair Straightening Serum 6 Fl. Oz. Framesi FRAMESI COLOR LOVER™ Hair Straightening Serum 6 Fl. Oz. False framesi/framesicolorloverhairstraighteningcream6oz.jpg Bonus Deal Available 13.95 13.95 9.77 True False False False 9.77 False False Diversion contract is required 0 Framesi Color Lover Hair Straightening Serum is a strong topical straightening serum. True Log in to view pricing! False

160905 988715 988715 1 Plumping Mousse Leave-in 5.1 Fl. Oz. Framesi Framesi Morphosis Repair Plumping Mousse Leave-in 5.1 Fl. Oz. False framesi/frammorphrepairplumpmousse.jpg Bonus Deal Available 16.65 16.65 11.66 True False False False 11.66 False False Diversion contract is required 0 Framesi Morphosis Repair Plumping Mousse Leave-in is a repairing leave-in mousse that provides an immediate effect of reconstruction and manageability for fine hair. True Log in to view pricing! False

154593 499011 499011 1 Frenzy Matte Texturizing Paste 2.5 Fl. Oz. Sexy Hair Frenzy Matte Texturizing Paste 2.5 Fl. Oz. False sexyhair/sexyhairstylesexyfrenzymattepaste2.5oz.jpg Bonus Deal Available 10.98 10.98 8.78 True False False False 8.78 False False Diversion contract is required 0 Sexy Hair Style Sexy Frenzy Matte Texturizing Paste delivers up to 48 hours of medium hold while adding texture, definition, and bulk for fuller looking hair. True Log in to view pricing! False

154588 499008 499008 1 Hard Up Hard Holding Gel 16.9 Fl.Oz. Sexy Hair Hard Up Hard Holding Gel 16.9 Fl.Oz. False sexyhair/sexyhairstylesexyhardupgel16.9oz.jpg Bonus Deal Available 18.48 18.48 14.78 True False False False 14.78 False False Diversion contract is required 0 Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a maximum high hold finish and humidity resistance that lasts up to 48 hours. True Log in to view pricing! False

154582 499007 499007 1 Hard Up Hard Holding Gel 5.1 Fl. Oz. Sexy Hair Hard Up Hard Holding Gel 5.1 Fl. Oz. False sexyhair/sexyhairstylehardupgel5.1oz.jpg Bonus Deal Available 10.98 10.98 8.78 True False False False 8.78 False False Diversion contract is required 0 Sexy Hair Style Sexy Hard Up Hard Holding Gel works on all hair types for a maximum high hold finish and humidity resistance that lasts up to 48 hours. True Log in to view pricing! False

78605 182414 182414 1 ProSeries 1 Bond-Protecting Color Optimizer Spray 8.4 Fl. Oz. Joico Joico Defy Damage ProSeries 1 Bond-Protecting Color Optimizer Spray 8.4 Fl. Oz. False joico/joidefypro18oz.jpg Bonus Deal Available 45.00 45.00 33.75 True False False False 33.75 False False Diversion contract is required 0 Protect hair from the ravaging effects of daily heat styling, UV exposure, and environmental pollution that lead to dry, dull, lackluster locks with Joico’s NEW Defy Damage haircare system. True Log in to view pricing! False

76052 182396 182396 1 Protective Shield 3.38 Fl. Oz. Joico Joico Defy Damage Protective Shield 3.38 Fl. Oz. False joico/joidefyprotectiveshield3oz.jpg Bonus Deal Available 15.55 15.55 11.66 True False False False 11.66 False False Diversion contract is required 0 Joico Defy Damage Protective Shield is made to guard against thermal and UV damage. True Log in to view pricing! False